KEGG   Bermanella marisrubri: HF888_16365
Entry
HF888_16365       CDS       T06527                                 

Gene name
traU
Definition
(GenBank) conjugal transfer pilus assembly protein TraU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
bmar  Bermanella marisrubri
Brite
KEGG Orthology (KO) [BR:bmar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmar02044]
    HF888_16365 (traU)
Secretion system [BR:bmar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HF888_16365 (traU)
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: QIZ85914
LinkDB
Position
pBma45:19165..20169
AA seq 334 aa
MLKNILLISVFTIVGLFSSSAFSVVCPGKFPNPVTDICWKCMFPIFIGPAGVTNGEVPTG
EVPPPVCTCPAPPPVFIRFGVGISFWEPARMAEVVRSPMCSPSLGGTKLGEFSLNATQGS
NSKGSTDVDDNMAFYHVHWFTYPLLSWVGSAITQGACMSTETLDLTAMSELDPTWSDDEL
TFFLNPEAVLFANPISIAACAADAVSASVSNFGLDPLFWCSGSAGPVYPLTGQISGNFSA
VDSSALEVHRFAYKLHRAGLAMDTSTYAAMCMPIPQPIIRKRQYKQNMVYPVPNPAWGTG
FGQTSTIWGVGKEFPYRGEDYAYLIWRKRMCCAF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgttgaagaatatcctattaattagtgtttttactattgtcggtttgttttcttctagt
gcattttcggttgtatgccctggaaaattcccaaacccagtaacggatatttgctggaag
tgcatgtttccaatttttatagggcctgcgggtgttactaatggagaggttcctactgga
gaggtgccaccgcctgtctgtacttgcccagcaccaccacctgtatttattcggttcgga
gtcggcatttctttttgggagccagcgagaatggcggaggttgtgaggtctccaatgtgt
tctccatcattgggtggtacaaagcttggagagttcagtctgaatgcaactcaaggtagc
aactctaaaggttctacagatgttgatgacaacatggcgttctatcatgttcactggttt
acataccctttgctttcatgggtcggctctgcaataacgcaaggtgcttgcatgagtaca
gagacattggacctaactgcgatgagtgagttagatccaacttggtcagacgacgaatta
acatttttcctaaacccagaagctgttttatttgctaatccaatatcaatagcagcctgc
gccgctgatgctgtttcggcatccgtatccaactttggcttagatccgcttttttggtgt
tctggcagtgctgggcctgtttatccactaacgggtcaaattagcggtaattttagtgcc
gtggatagctctgcactagaagttcatcgtttcgcatacaaattacatagggctggtttg
gcaatggatacatcaacttatgcagcgatgtgtatgcctattccacaaccaataattaga
aagcgtcaatataagcagaatatggtttacccagtgccaaatcctgcttggggaacaggc
tttggtcaaacctcgactatttggggggttggtaaggaattcccataccgaggtgaggat
tatgcttatttaatatggaggaaaagaatgtgttgcgctttctag

DBGET integrated database retrieval system