KEGG   Bermanella marisrubri: HF888_16415
Entry
HF888_16415       CDS       T06527                                 

Definition
(GenBank) ParB/RepB/Spo0J family partition protein
  KO
K03497  ParB family transcriptional regulator, chromosome partitioning protein
Organism
bmar  Bermanella marisrubri
Brite
KEGG Orthology (KO) [BR:bmar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmar03000]
    HF888_16415
   03036 Chromosome and associated proteins [BR:bmar03036]
    HF888_16415
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bmar04812]
    HF888_16415
Transcription factors [BR:bmar03000]
 Prokaryotic type
  Other transcription factors
   Others
    HF888_16415
Chromosome and associated proteins [BR:bmar03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    HF888_16415
Cytoskeleton proteins [BR:bmar04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   HF888_16415
SSDB
Motif
Pfam: ParBc
Other DBs
NCBI-ProteinID: QIZ85924
LinkDB
Position
pBma45:30764..31654
AA seq 296 aa
MKGAGFGKQGSPTLEHANQEKLVSSLDELLGQGKPEQILKIHHSKIEPDPLQPRRKIDEA
GIKALSESIKLNGQAQPITVIPLGDDTYRIVAGERRWRAAKLADLEVVAYVRGDLDETQI
RLIQVAENVDREDMTVEDTARAYVGIVNVLTESGLEKKKAIERAGISKTEFYRWQTINEA
FEAEDSSIQIVSTVTADLRSLEEFRRLEKKAPDLSSKIIKKIQGDKLKGSLREEIDSLTK
PKKKQEKQSPVSYEIENAELVGEEILVDISKGGKAKSTLKIDKSSLALLNGLFENE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaaaggcgcaggttttggtaagcaaggatctcccacgcttgagcacgccaatcaagag
aagctagtgagcagtcttgatgagttattggggcaggggaaacctgaacaaattcttaaa
attcatcattcgaaaattgagccagatccattgcagccacgtcgaaaaatcgatgaggct
ggaatcaaagcactttccgagagcattaagctgaatgggcaagctcagcctatcactgtc
attcctttaggtgatgatacgtatcgcatagtcgcaggtgagcgtcgatggagagctgca
aaactagcggatctcgaagtagttgcttatgtgcgtggtgacttagatgaaacccagatt
cgactaatacaggttgccgagaacgtagaccgcgaggatatgacggtcgaggatactgct
agggcttatgttggtattgtaaatgtacttactgagtcaggcttagaaaagaagaaagct
attgagcgagcaggtattagtaagactgaattttatcgttggcagacgataaatgaagcc
tttgaagcagaggatagtagtattcaaattgtgtctacagtgacagctgatttacgcagc
ctagaagaatttcgtaggctcgaaaagaaagctccagatttgagctctaaaataataaag
aaaattcaaggtgacaaattaaaaggtagtttgcgagaagagattgactctttaacaaag
ccaaaaaagaaacaagaaaagcagtcaccagtttcgtatgaaatcgagaatgcagaatta
gttggtgaggaaattctagtagatatatcgaaaggcggtaaagcaaagtctactttgaaa
attgataagtcctccctagcacttttaaatgggttatttgaaaatgagtga

DBGET integrated database retrieval system