KEGG   Bermanella marisrubri: HF888_16445
Entry
HF888_16445       CDS       T06527                                 

Definition
(GenBank) hypothetical protein
Organism
bmar  Bermanella marisrubri
SSDB
Motif
Pfam: DUF4271
Other DBs
NCBI-ProteinID: QIZ85930
LinkDB
Position
pBma45:33856..34290
AA seq 144 aa
MTEILSSIFTNTIGGIATVLLFKFLAKRSKKVRREKLVQLSEEKENIENMREDTDLFLRY
SFYSLFRMIFLIMVGVFGYLLTLFPSQTVERAPDVWYMFLFTLSAILLVGSFQEARSAEL
VLDSKKFESYFSKKMKKFKSNDDA
NT seq 435 nt   +upstreamnt  +downstreamnt
atgactgagatcttgagtagtatttttactaataccattggtggaattgctacggtattg
ttgtttaagtttctagcaaaacgcagtaagaaagttagacgagaaaaactcgttcaatta
agcgaggaaaaagaaaatatcgagaatatgcgagaggatactgacttgtttttgcggtat
tcattttattccctatttagaatgatctttctaattatggttggcgttttcggatatctt
ctaaccttatttccttcgcaaacagtggaaagggctccagacgtttggtatatgttcctc
ttcactctatcagcgattctattggttggtagttttcaagaggctagatctgccgagctt
gtcttagattccaagaaattcgagtcttacttttctaagaaaatgaaaaagttcaagtct
aatgacgatgcttaa

DBGET integrated database retrieval system