KEGG   Bermanella marisrubri: HF888_16450
Entry
HF888_16450       CDS       T06527                                 

Definition
(GenBank) SAM-dependent DNA methyltransferase
Organism
bmar  Bermanella marisrubri
SSDB
Motif
Pfam: N6_Mtase
Other DBs
NCBI-ProteinID: QIZ85931
LinkDB
Position
pBma45:34677..35417
AA seq 246 aa
MGSQVDTFIKAFNQLVHHRNKYDVFKDFVYLSSISIQNAFLKSQELEGEYLELISKYNKD
ESLVIASLLGEVIIALEGSHSDFLGAVYMELDIGSSHIGQFFTPYDVSRMMAKAIYADSF
SLLEEKPFLTLCEPCVGAGSMVIAIADEMLSNGFNPQNQLWVSCVDIDPLAARMAFIQLS
LLGIPAEVIVGNTLTMKVTEVFRTPMHFIGFWDSKLSKLNEDVSLVEPDSIINVEKDQYD
LFSLVS
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggttctcaagttgatacctttattaaagcatttaaccagttggtgcatcatagaaat
aaatatgatgtatttaaggactttgtctatttgtcatccatttcgattcaaaatgctttt
ttgaaatcacaggaattggagggtgagtatttagagcttatttctaaatacaataaggac
gagtctttggttatagcttcattactaggagaggtcattattgcactcgagggatcgcat
agtgatttcttaggggcagtttatatggagctggatatcggatcgagtcacattgggcag
ttttttacgccctatgatgtgtctcggatgatggcaaaagctatctatgccgactccttt
agcttgctcgaagaaaagccgtttctaacactttgcgaaccatgcgttggtgcaggatct
atggtgatagcaattgctgatgagatgctgtccaatggcttcaatccacaaaatcagttg
tgggttagttgtgtagatatagaccctttggcagcaagaatggcgtttattcagctgagc
ttgttaggtattcccgccgaagtcattgtcggaaataccttaacaatgaaggttacggag
gtcttcagaacacctatgcatttcatagggttttgggattcgaaactatcaaagttgaat
gaggatgtatccttagttgaacccgactcaatcataaacgtagagaaagatcagtatgat
ttattttctctagtttcatga

DBGET integrated database retrieval system