KEGG   Bermanella marisrubri: HF888_16465
Entry
HF888_16465       CDS       T06527                                 

Definition
(GenBank) DUF1738 domain-containing protein
Organism
bmar  Bermanella marisrubri
SSDB
Motif
Pfam: MPTase-PolyVal ArdcN
Other DBs
NCBI-ProteinID: QIZ85934
LinkDB
Position
pBma45:37508..38413
AA seq 301 aa
MKKRRDLKAEITQKIVDRIEQGGLLPWICPWDIKQCSPIPVNFGTKKAYTGMNVLLLWME
AVDRGYSNNQWLTFKQAKALGGSVRRGEKSTTCIFYKSVEIDDEQEEDGKKQIPVMKPFN
VFNVEQIDGLELPNARPIPNIEQGDLNLSLVKSIEQYCKIQGIALRNGGNRAYYSPSLDL
IKIPDGFFDASGMAATLAHEAGHSTGHKKRLDRFEKFDNDFDKEIEAYAFEELVAETFSA
LLCGEYGVPLQTDNHASYLNSWLKAMKGDTSFIFKAASHAYKAFDYFQDSVKAGGASIEA
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaagaaacgtagagatcttaaagctgagattactcaaaaaatcgtagatcgtattgag
cagggtggtttattaccttggatttgtccttgggatataaagcaatgctctccaatacct
gtgaattttggcactaaaaaagcctatacaggtatgaacgttttgttgctttggatggag
gctgttgatcgtggttactcgaacaatcagtggcttacatttaagcaggccaaagcgctt
ggcgggagtgttcgacgtggtgaaaagtctacgacctgcattttttataaaagtgtagag
atcgatgacgagcaagaagaagatgggaagaaacagatcccagtgatgaagccattcaat
gtgtttaatgttgagcagattgatggcttggaacttccaaatgcacgcccaattcccaat
attgagcagggtgatttaaacctttctttggtcaaatcgattgagcaatattgcaaaatt
cagggtattgctttgagaaatggcggcaatagagcctattactcaccttcattagacttg
atcaaaatacctgatggcttctttgatgcctctggtatggcggctacgcttgcgcatgaa
gctggacactcgactggtcataaaaagcgtcttgatcgttttgaaaagtttgataatgac
tttgacaaagagattgaggcatatgcctttgaagagttggtagctgagacttttagtgct
ctgttgtgcggtgaatacggtgttccattgcaaactgataaccatgcaagttatttaaac
tcttggttaaaggcaatgaaaggggatacttcattcatttttaaggccgcttcgcatgcc
tacaaggctttcgactatttccaagatagtgtgaaagctggcggtgcttctatcgaagca
gcatag

DBGET integrated database retrieval system