KEGG   Borrelia mayonii: A7X70_01205Help
Entry
A7X70_01205       CDS       T04886                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmay  Borrelia mayonii
Pathway
bmay00564  Glycerophospholipid metabolism
bmay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7X70_01205
Enzymes [BR:bmay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A7X70_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 GIDA NAD_binding_8 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: APS98459
UniProt: A0A1L6VPX1
LinkDB All DBs
Position
249339..250901
Genome map
AA seq 520 aa AA seqDB search
MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKTILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALQEKAILEKNAPHLINECALITPIYNILEIPYYYFGLVYY
HNLMGKEKTAKYKTKLLSKTSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAITLLRTFTE
KGGIALNYTELKKFNKENGKLSGALIQNKFSKEQISLKSKCIINATGIFSDEIRKLDDEK
ALNIIKPSQGSHLIIKKDKFPKNHAILMPKTSDNRILFAIPWHDSVVCGSTDIPIKEIEE
EPKRFDEEIDFIINNLNNYLNIKIDKSDVKSVYTGIRPLIMDPKAEGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNCKPTTENLKLHGYLKKEEAMKIPEP
FRAYGSDFEILKNMEGFDKKIHKNLDLNEAQIAFSIEFEQAKTIEDVLARRTRSLPLNPQ
ATIEAAPRVAEIMMKKLNKSEEWKNEQIKNFLEISKKYLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaaacaaaattaaaagatcttgaaaatcaagaatttgatcttata
ataattggaggaggcgcaacaggtcttggcattgcagtagacgcaatcacaaggggatat
aaaacaatacttatagaaaaatttgattatgcaaaaggaacttcctctagatcaagcaaa
ttaattcacggcggagtaagatatttagcccaatggaatatttctttagttaaagaagct
ttacaggaaaaagccattcttgaaaaaaatgcacctcatttaattaacgagtgtgcgctt
atcactcctatttataatattttagaaataccttattattattttggattagtttactat
cacaatcttatgggcaaagaaaaaactgccaaatataaaactaaattactatccaaaaca
tctaccatcgaaaaagctcctaatattaaaacagaaggtcttaaatgctctgttctatat
tacgacgattcatttgatgatgctagaatggcaataacattactaagaacttttaccgaa
aaaggaggtattgcacttaactatacagaacttaaaaaattcaacaaagaaaacggaaaa
ctttcaggagctctcatacaaaataaattttcaaaagaacaaatttcattaaaaagcaaa
tgcataataaacgcaacaggaatattttcagatgaaataagaaaattggatgatgaaaaa
gctttaaacatcattaaaccttcccaaggtagccatttaataatcaaaaaagataaattt
cccaaaaatcatgcaatattaatgcctaaaactagtgataataggattttatttgctatt
ccttggcatgatagtgttgtttgcggaagcactgatattccaataaaagaaatagaagaa
gaacctaaaagatttgacgaagagattgactttataataaataatttaaacaactattta
aatattaaaatagacaaatcagatgtaaaaagtgtatataccggaataagaccattaata
atggacccaaaagctgaaggcaacacttcaaaaatctcaagaaatgaaaaaatatttata
tcagattcaaatcttattacaatagcgggaggcaaatatactacatatagaaaaatggca
gaaaaaactttgctcaaggccatagaaaaaaatttaataccaaattgcaaaccaactaca
gaaaatttaaagttgcacggctaccttaaaaaagaagaggcaatgaaaattcctgaacct
tttagagcttatggcagcgactttgaaattctaaaaaatatggagggttttgacaaaaag
atacacaaaaacttggatttaaatgaagcccaaatagctttttcaattgaatttgagcaa
gccaaaactattgaggatgttttagcaagaagaacaagatcgctacccttaaatcctcaa
gctacaattgaagccgctccaagagttgctgaaataatgatgaaaaaattaaataaatct
gaagagtggaaaaatgaacaaataaaaaactttttagaaataagtaaaaaatatttaatt
taa

DBGET integrated database retrieval system