KEGG   Burkholderia mallei NCTC 10247: BM44_2086Help
Entry
BM44_2086         CDS       T03524                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00020  Citrate cycle (TCA cycle)
bmaz00310  Lysine degradation
bmaz00380  Tryptophan metabolism
bmaz01100  Metabolic pathways
bmaz01110  Biosynthesis of secondary metabolites
bmaz01120  Microbial metabolism in diverse environments
bmaz01130  Biosynthesis of antibiotics
bmaz01200  Carbon metabolism
Module
bmaz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmaz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BM44_2086 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BM44_2086 (sucB)
   00380 Tryptophan metabolism
    BM44_2086 (sucB)
Enzymes [BR:bmaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BM44_2086 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AIS29977
LinkDB All DBs
Position
1:complement(2327562..2328836)
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAAPAPAAQPAAAASSTAA
TSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPEV
KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagtcggccgccgct
cccgtcgccgcgccggcgcccgccgcgcagccggccgccgccgcgtcgagcaccgcggcc
acatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtcgcc
ggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcgccg
aaggccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtg
aaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatg
tcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatc
ctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaag
gacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcg
gccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatc
gtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtg
ccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaa
ttcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggtggcacgttc
tcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccg
cagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccag
atcgtgatccgcccgatcaactatcttgcgctgtcgtacgaccaccggatcatcgacggt
cgcgaagcggtgctgtcgcttgtcgcgatgaaggacgcgctcgaagatccggcgcgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system