KEGG   Burkholderia mallei NCTC 10247: BM44_2571Help
Entry
BM44_2571         CDS       T03524                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BM44_2571
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmaz02000]
    BM44_2571
Enzymes [BR:bmaz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BM44_2571
Transporters [BR:bmaz02000]
 Other Transporters
  Pores ion channels [TC:1]
   BM44_2571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIS29900
LinkDB All DBs
Position
1:complement(2888490..2889146)
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLMTEHGSL
CESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVV
DAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctttgtggttttccagtgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtcccgatcaaggaccccgcg
tttttggccgatacgccgctcggcaaggtgccgtatctgatgaccgagcacggctcgctg
tgcgaatcgcaggcgatcatcgaatatcttgccgcgattcatcccgacaagcccattttc
ccggccgatccgttcgcggcggcgaaggcgcgcgagatcacggcggtgctcgagctgtac
ctcgaatggaacgtgcgcgaactgtttccggaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctggacggtttcaagcggctc
gcgaaattttcgccgtacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
atccatctgccggtcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcgtcgtc
gacgcggggatcgactggaaggcgtacgtgaagcgcatcgaggaagcgcggccggccgcg
aagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system