KEGG   Brucella abortus S19: BAbS19_II06030Help
Entry
BAbS19_II06030    CDS       T00703                                 

Definition
(GenBank) Glu-tRNAGln amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bmc  Brucella abortus S19
Pathway
bmc00970  Aminoacyl-tRNA biosynthesis
bmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAbS19_II06030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmc03029]
    BAbS19_II06030
Enzymes [BR:bmc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAbS19_II06030
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAbS19_II06030
Mitochondrial biogenesis [BR:bmc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAbS19_II06030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ACD74098
UniProt: B2SB61
LinkDB All DBs
Position
2:634717..635004
Genome map
AA seq 95 aa AA seqDB search
MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEVDVEGIEPMTSVTPMKM
RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgatatttctaccgtcaagcgcgtcgcgcatctggcgcgcatcgccgtcagc
gaagacgatgcagaacgcatgaccggagagctgaatgcaattctgggctttgtcgagcaa
ttgaatgaagtcgatgtcgagggcattgaaccgatgacgtctgtgacgccgatgaagatg
cgtatgcgtgaagacaaggtgacagacggtggcattgccgccgccgtggtggccaatgcg
ccggtgacggaagacaatttcttcgtggttccgaaggtcgtggagtaa

DBGET integrated database retrieval system