KEGG   Brucella abortus S19: BAbS19_II06040Help
Entry
BAbS19_II06040    CDS       T00703                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bmc  Brucella abortus S19
Pathway
bmc00970  Aminoacyl-tRNA biosynthesis
bmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAbS19_II06040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmc03029]
    BAbS19_II06040
Enzymes [BR:bmc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAbS19_II06040
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAbS19_II06040
Mitochondrial biogenesis [BR:bmc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAbS19_II06040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACD74099
UniProt: B2SB62
LinkDB All DBs
Position
2:635063..636544
Genome map
AA seq 493 aa AA seqDB search
MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAYVAVTHDQARSMAKASD
ERIAKGEAGALEGIPLGVKDLFATKGVHTQACSHILDGFKPEYESTVTANLWADGAVMLG
KLNMDEVAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSSGGSAAAVAAHLCAGATATDT
GGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQAGPIARDVRDAAILMKSMASLDL
KDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDGMPGEIEELWQKGIQYLKDAGAEIV
DISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPGKDIADMYEQTRAAGFGKEVK
RRIMIGTYVLSAGYYDAYYLRAQKVRTLIKKDFEDVFAKGVDAILTPATPSAAFGLADEV
LANDPVKMYLNDIFTVTVNMAGLPGIAVPAGLNGQGLPLGLQLIGRPFEEETLFQAAHVI
EQAAGRFTPAKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaccgcactgaccattgccgaagcgcgcgacaagttgaaagccaaggcc
attaccgcgaccgagctgacggacgcctatctttccgctatcgatgccgccaatgacgcc
atcaatgcctatgtggccgtcacccacgatcaggcgcgttccatggccaaggcttcggat
gaacgcatcgcgaagggcgaagcgggcgcattggagggcattccgctcggcgtgaaggac
ctgtttgcaaccaagggcgtgcacacgcaggcctgctcgcacattctggacggtttcaag
ccggaatatgaatcgaccgtcaccgccaatttatgggctgatggcgcggtcatgctcggc
aagctcaatatggatgaggtcgccatgggctcctccaacgaaacttcctattacggtccg
gtgaaaaatccgtggcgcgccaagggttccaatgccgatctggtgccgggcggctcgtcc
ggcggttcggctgccgccgttgccgcgcatctttgcgcgggcgcgactgcgaccgatacg
ggcggctcgatccgccagcctgccgcctttaccggtacggtcggcatcaagccaacctat
ggccgtgtttcgcgctggggtacggtggctttcgcctcgtcgctcgatcaggcaggcccg
attgcgcgcgacgtgcgcgatgctgcgatccttatgaagtccatggcttcgctcgatctc
aaggacacaacttccgttgacctgccggtgccggattatgaagcagccctcggcaggtct
gtgaagggcatgaagatcggcattccaagggaatatcgtgtcgatggcatgccgggcgaa
atcgaggaactctggcagaagggcatccagtatctgaaggatgcaggtgccgagattgtc
gatatttcgctgccgcataccaaatatgcgctgcctgcttattatatcgtggcgcctgcg
gaagcttcgtccaacctcgcacgttatgatggcgttcgttatggcctgcgcgtgcccggc
aaggatattgccgacatgtacgaacagacccgcgccgcaggcttcggcaaggaagtgaag
cgccgcatcatgatcggcacctatgtcctgtcggcgggctattacgacgcttattacctc
cgcgcccagaaggtgcgtacgctgatcaagaaggatttcgaggacgttttcgccaagggt
gtggatgctatcctgaccccggccacgccttcggcggctttcggccttgccgatgaagtc
ctcgccaacgacccggtcaagatgtacctgaacgatatctttaccgtcaccgtgaacatg
gcgggattgccgggcatcgcggtgcctgccgggctgaacgggcagggcctgccgcttggc
ctccagcttatcggccgccccttcgaggaagaaacgctgtttcaggcagcccatgtcatc
gagcaggctgccgggcgtttcacgccagcgaagtggtggtaa

DBGET integrated database retrieval system