KEGG   Bacillus megaterium DSM 319: BMD_0213Help
Entry
BMD_0213          CDS       T01219                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00473  D-Alanine metabolism
bmd00550  Peptidoglycan biosynthesis
bmd01100  Metabolic pathways
bmd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMD_0213 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMD_0213 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMD_0213 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmd01011]
    BMD_0213 (ddl)
Enzymes [BR:bmd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMD_0213 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bmd01011]
 Precursor biosynthesis
  Amino acid ligase
   BMD_0213 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADF37144
UniProt: D5D9X4
LinkDB All DBs
Position
191088..192170
Genome map
AA seq 360 aa AA seqDB search
MKIKLGLLYGGKSAEHKVSLQTALAVSKAINHDKYEVHPIYITETGKWIRGTQLTGPLET
VAQLEIQDNGTAISPVSLNTEMFALTDSKTDDQLDVIFPLLHGPNGEDGTVQGLLELLNI
PYVGNGVLASAAGMDKVVMKQLFAQAGLPQVEYVSFIRREWEADRTAAYEKVETLGYPCF
VKPANLGSSVGISKCDNREELEAAFVEAFLFDRKIIVEAAAVGREVEIGVLGNDEAACSV
VGEILPKKAFYDYKAKYEDGDTGLIIPAEITEEQHQEMSALAIKAFKAIDGSGLVRADFF
LTSEGKFIINEVNTMPGFTPFSMFPLLWKHAGVEYPDLIEKLVSLAIERHTEKQQIKHTM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaagcttggccttttatacggaggaaaatccgctgaacataaagtatcttta
caaacagctctagcagtttcaaaagcaattaatcacgataaatatgaagtgcatccaatt
tacattacagaaacaggaaagtggattcgcggcacacagctgactggtccgcttgaaaca
gttgctcaattagaaattcaagataacggaactgctatttcaccagtttcattgaatacg
gaaatgtttgcattaacagattcaaaaacagatgatcagctagatgttattttcccactt
cttcatggtccaaatggagaagatggtacggtacaaggattattagaattattgaatatt
ccttatgttggaaatggtgtattagcttcagcagctggtatggataaagttgtaatgaag
cagctgtttgcacaggcaggtctccctcaagtagagtacgtatcatttatccgccgcgag
tgggaagcagatcgaacggctgcttatgaaaaagtagaaacacttggatacccttgcttt
gttaaaccagcaaacttaggttcaagcgttgggattagcaaatgtgataaccgagaagag
ttagaagcagcatttgttgaagctttcttattcgatcggaaaatcattgtagaagcagca
gcagttggtcgtgaagttgaaattggtgtgttaggtaatgatgaagcagcttgttcagta
gttggagaaatcttacctaaaaaagcgttttacgattacaaagccaaatatgaagacggc
gatacaggccttattattccagctgaaattacagaagaacagcatcaagaaatgtcagca
ctagcaatcaaagcatttaaagcaattgatggatctggtcttgtacgtgcagatttcttc
ttaacatcagaaggtaaattcattattaatgaagtgaatacaatgcctggttttacacct
ttcagtatgttcccgttattgtggaaacacgcaggtgttgaatatccagatttaatcgaa
aaacttgtatcactagcaattgaacgtcataccgaaaagcagcaaattaaacacacaatg
taa

DBGET integrated database retrieval system