KEGG   Bacillus megaterium DSM 319: BMD_0535Help
Entry
BMD_0535          CDS       T01219                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00564  Glycerophospholipid metabolism
bmd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMD_0535 (glpD)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BMD_0535 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored GIDA DUF3606 NAD_binding_8 GMC_oxred_N Pyr_redox Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: ADF37421
UniProt: D5DAC0
LinkDB All DBs
Position
506578..508257
Genome map
AA seq 559 aa AA seqDB search
MFSSQTRSNKLVDMTQNQYDLLVIGGGITGSGIALDATHRGMKTALVEMQDFAAGTSSRS
TKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGKFSTSIG
LRVYDFLAGVKRSERRKMFSAEETLSREPLVKSKDLKGGGYYVEYKTDDARLTIEVAKEA
AARGADLVNYTKVENFIYDKGKVVGAVVRDQLTNKEYNIYAKKIVNAAGPWVDTLREKDN
SKKGKQLQLTKGIHLVIDQERFPLKQAIYFDTPDGRMVFAIPRDGKTYVGTTDTVYKEDA
RHPRMTVKDRQYVIDAINYMFPTVDITVDDVESSWAGVRPLIHEQGKDPSEISRKDEIWT
SESGLITIAGGKLTGYRKMAEIVVNRVAEDFKAEGREFESCQTKHLPISGGNVGGSGGFP
TFVEQKVKEGIKLGLSRDAAEKLVKRYGSNVDKVYRYMIERPDQLKNSDLPASVFLQIQY
GIEEEMVSKPVDFFIRRTGALFFDINWVRSWKKQVIAHMAEELKWTPEQTKAYKDELEQH
LHDAVVPVDEKVNRMTGIS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaagtcaaacacgttcgaataaattggtagacatgacacaaaatcaatatgat
ttactagtaattggtgggggaattactgggtcaggtattgcacttgatgcgactcatcga
ggcatgaaaacggcattagttgaaatgcaggatttcgcagcaggaacatctagtcgttca
acgaagcttgttcacggcggtctacgctatttaaaacagtttgaagttaaaatggtagcc
gaagttggtaaagaacgtgccatcgtatatgaaaatggccctcatgtaacgactcccgag
tggatgctgttacctttccatacgggtggaacattcggtaaattctcaacttcaattgga
ctgcgcgtatatgattttttagctggtgtaaaacgctcagagcgccgcaaaatgtttagc
gcagaagaaacgcttagccgcgagccattggtgaaatctaaagatttaaaaggcggcggt
tactacgttgaatataaaacagatgatgcacgtttaacgattgaagtagctaaagaagct
gcagcaagaggagcagacttagtcaattacacaaaagtggaaaacttcatctacgataaa
ggaaaagtagtaggggctgttgttcgtgatcagcttacgaataaagaatataatatctat
gcgaaaaaaatcgttaacgctgcaggtccatgggtggacacgctgcgtgaaaaagataat
tcaaaaaaaggcaagcagcttcaattaacaaaagggattcacttagttattgatcaagag
cgctttccgttaaaacaagccatttattttgatacacctgatggacgtatggtatttgcg
attccgcgtgatggaaaaacatacgtaggcacaacggacacggtctataaagaggacgct
agacatccgcgtatgactgtaaaagaccgtcaatatgttattgatgcgattaactatatg
ttcccaacggttgatattacagtagacgacgtagaatcaagctgggcgggagttcgtcca
cttattcacgaacaaggaaaagatccttctgaaatctcgcgtaaagatgaaatctggaca
tcagaatcaggtttaattacaatcgctggagggaaattaactgggtatcgtaaaatggct
gaaattgtcgtaaatcgtgtagctgaagattttaaagcagaaggacgcgaatttgaaagc
tgtcaaactaaacatttaccgatttctggaggtaatgtaggcggttcaggtgggttccca
acgtttgtagagcaaaaagtcaaagaaggcatcaaactagggttatcacgtgacgctgct
gaaaagcttgtaaaacgctatggctcaaacgtagataaagtataccgctacatgattgaa
cgtcctgatcagctaaaaaacagcgaccttccagctagtgtatttctgcaaattcaatat
ggcatagaagaagaaatggtttcaaaaccagtggacttcttcattagacgtacgggcgct
ttattctttgatatcaactgggtaagaagctggaaaaaacaagtgattgctcatatggcc
gaagagttaaagtggacgcctgagcaaacaaaagcttataaggatgaattagaacagcac
cttcatgacgcagttgtaccagtagatgaaaaagttaaccgtatgacaggtatttcatga

DBGET integrated database retrieval system