KEGG   Bacillus megaterium DSM 319: BMD_0812Help
Entry
BMD_0812          CDS       T01219                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00620  Pyruvate metabolism
bmd00680  Methane metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
Module
bmd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_0812
  09102 Energy metabolism
   00680 Methane metabolism
    BMD_0812
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMD_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SSXRD FXR_C1
Motif
Other DBs
NCBI-ProteinID: ADF37674
UniProt: D5DB23
LinkDB All DBs
Position
789505..792273
Genome map
AA seq 922 aa AA seqDB search
MVTVEAAERQNSSTALRRDVKFLGQLLGKVLVHQGGEELLSKVEKIREVAKSLRENKDEV
IYKEIKNEIVTLEQPMREQVIRAFAVYFHLVNIAEQNHRIRRRREYQQQEDSIMQPGSLE
SAVVSLKNNGVAPDVIANLLQTLSLELIITAHPTEATRRSVLDIHKRMAELLKNLDNPTL
TKRERTEIEERLFSEVLILWQTNELRDRKPTVMDEVSNGLYYFDETLFEVLPQLHQELEN
SLQENYPEENWKVPNILRFGSWIGGDRDGNPNVTPKVTWQTLVKQRKLAIRKYKESLTQL
RQRLSQSTKRVAVSDNLLDSINQEISLLPEKKRWRIKHEVYRCKLTIMLHKLNLVGESEA
GYQRSEELLHDLFLIKDSLQKHQPQDYQLKSLCKLIRQVELFGFHLATLDIRNHSGEHEA
AIKEIFHAVSLAEDYSALTEEKKVELLGKVLQDPRPVISFVENYSKETQQVIEVFNMIHR
AHKEFGERSIEVYLISMTQSASDLLEVMVLAKEAGIYRLHADGRIESKLNIAPLLETIDD
LTAGPKIMEQLFQLDFYREHLREQQDLQEIMLGYSDGSKDGGTLTANWKLYKAQQEIHDM
AKKYQVRLKFFHGRGGSLGRGGGPLNRSILSQPVETLGDGVKITEQGEVLSSRYALYDIA
YRSLEQAVSALLTAAANVSQEAEQCDIRTHEWEETMDEISTASLRKYQELVFKDPDFLTY
FKQATPLPELGALNIGSRPMSRKGSDRFEDLRAIPWVFAWTQSRQLLPAWYAAGTGLQHL
VEKSGDIQLLQQMYKEWPFFRSTVDNLQMALTKADLMAAKEYTEMVQDPAISERIFTAIK
KEYNLTKEMILQITGQKELMDHLPTIKESIKLRNPYVDPLTFLQVKVISKLREDEAGTLN
EELLKEALLTINGIAAGLRNTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagtagaagcagcagaaagacaaaacagcagcactgccctgcgccgtgatgtt
aagtttctcggtcaattgttagggaaagttctggttcatcaaggtggagaagaactgctc
agcaaagtagaaaaaatacgcgaagtagcaaaatcacttagagaaaacaaagatgaagtt
atctataaagaaataaaaaatgaaatcgttactcttgaacagccgatgcgcgagcaggtt
attcgggcgtttgcagtttattttcatttagttaatattgcagagcaaaatcatcgaatt
cgtcgcagacgcgaatatcagcagcaagaagattctattatgcagccgggctcattggaa
agtgccgttgtttcgcttaaaaataatggcgtggcgccagacgtaattgctaacttgctt
caaactctatctctagagctcatcatcactgctcatccaacagaagccactagacgaagt
gtccttgatattcataaacgaatggctgagcttctaaaaaacttggataacccaacgtta
acaaaacgtgaacgtacggaaattgaagaaagactgtttagcgaagtattaattttatgg
caaacaaatgaactgcgagatcgcaagccgacggtaatggatgaagtatccaatggatta
tattattttgatgaaacgttatttgaagtgcttcctcaacttcatcaggagttggaaaat
tcattgcaggagaattaccccgaagaaaattggaaggtgcctaatattcttcgatttggt
tcatggattggcggagaccgagatggaaatccaaacgtaactcctaaagtaacctggcaa
acgcttgtcaaacaaaggaagttagctattcgtaaatataaagagtcgcttactcaattg
agacaaaggttaagtcagtctacaaaaagagtcgcagtttcagataatcttcttgattct
attaatcaagaaatatcgctgctgcctgagaaaaagcgatggagaatcaaacacgaagta
tatcgctgcaagcttacgattatgcttcataaattaaatttagttggagaatcggaagca
ggttatcaaaggtcggaagaacttctacatgatttatttctaatcaaagatagcctgcaa
aagcaccagcctcaggattatcagttaaaaagcttatgtaaattaattcgccaagttgag
ctgtttggttttcatttagcaacgcttgatatccgtaatcacagcggggaacatgaagcg
gcaatcaaagaaattttccatgctgtttctttagctgaagattattcagcgttaacggaa
gagaaaaaagtcgagctgctagggaaagttcttcaagacccaagacctgtgatatcgttt
gtagagaattactctaaagaaacgcagcaagtaattgaagtatttaacatgatacatcga
gcacataaagaatttggagaaagatctattgaagtctacttaatcagtatgacgcagtct
gcaagtgacttgttagaagtcatggtactcgctaaagaagcgggtatttaccgccttcat
gcagatggccgcattgaaagtaagttaaatatagctccgctgcttgaaacgattgatgat
ctcacagcgggtcctaaaatcatggaacagctatttcaattagatttttatcgtgagcac
ttaagggaacagcaggatttgcaggaaattatgcttggctactcagatggaagcaaagat
ggaggaacgcttactgctaattggaagctctacaaagcgcagcaggaaattcatgatatg
gcgaagaagtatcaagttcgtctgaagtttttccatggtcgaggcggctcactaggccga
ggcggtgggccgttaaaccgaagcattttatctcagcctgttgagacgctaggagacggt
gtgaaaattacagagcaaggagaagttctttcttctagatacgctttatatgacattgct
taccgaagccttgaacaagcggtctctgctcttcttacagcggcagcaaatgtttctcaa
gaagctgaacaatgtgatattcgtacacatgaatgggaagaaacaatggacgagatttca
actgcttctttacgtaagtatcaagagcttgttttcaaagatccagactttttaacgtat
tttaaacaagctacacctcttcctgagctgggggctttaaatattgggtcacgtccaatg
agtcgaaaaggaagtgatcgctttgaagacttgcgagcgattccgtgggtatttgcatgg
acgcaaagcagacagctgcttccagcctggtacgctgcaggtacgggcttacagcattta
gtagagaaatccggagatatacagcttcttcagcaaatgtataaagaatggccattcttc
cgctccaccgtcgataatctgcaaatggccttaacaaaagcagatttaatggcagcaaaa
gaatacacggaaatggtacaagacccggctatttcagagcggatttttaccgccattaaa
aaagagtataatctcacaaaagaaatgattcttcaaatcacaggtcaaaaagaattaatg
gatcatcttcctacgattaaagaatctattaaattacgaaatccgtatgtggaccctcta
acattcttacaagttaaggtcatttccaagctgcgtgaagatgaggctggaacgttaaat
gaagaacttttaaaagaagcgttattaacgattaacggcattgcagcagggttgcgtaac
acaggctga

DBGET integrated database retrieval system