KEGG   Bacillus megaterium DSM 319: BMD_1215
Entry
BMD_1215          CDS       T01219                                 

Gene name
phaB
Definition
(GenBank) acetoacetyl-CoA reductase
  KO
K00023  acetoacetyl-CoA reductase [EC:1.1.1.36]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00630  Glyoxylate and dicarboxylate metabolism
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_1215 (phaB)
   00650 Butanoate metabolism
    BMD_1215 (phaB)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.36  acetoacetyl-CoA reductase
     BMD_1215 (phaB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Other DBs
NCBI-ProteinID: ADF38076
UniProt: D5DCX7
LinkDB
Position
1204915..1205658
AA seq 247 aa
MTTLQGKVAIVTGGSKGIGAVITRELASNGVKVAVNYNSSKESAEAIVKEIKDNGGEAIA
VQADVSYVDQAKHLIEETKAAFGQLDILVNNAGITRDRSFKKLGEEDWKKVIDVNLHSVY
NTTSAALTHLLESEGGRVINISSIIGQAGGFGQTNYSAAKAGMLGFTKSLALELAKTGVT
VNAICPGFIETEMVMAIPEDVRAKIVAKIPTRRLGHAEEIARGVVYLAKDGAYITGQQLN
INGGLYM
NT seq 744 nt   +upstreamnt  +downstreamnt
atgacaacattacaaggtaaagtagcaatcgtaacaggcggatctaaaggtatcggggca
gtaattacacgtgagcttgcttctaatggagtaaaagtagcagtaaactataacagcagt
aaagaatctgcagaagcaattgtaaaagaaattaaagacaacggcggagaagctattgcg
gttcaagctgacgtgtcttatgtagatcaagcaaaacacctaatcgaagaaacaaaagct
gcgtttggtcaattagacattctagtaaacaatgctggaattacgcgcgaccgttcattc
aagaagttaggtgaagaagattggaaaaaagtaattgatgtaaacttacatagcgtatac
aatacaacatcagctgcgctaacgcaccttttagaatctgaaggcggtcgtgttatcaat
atttcatcaattattggtcaagcgggcggatttggtcaaacaaactactcagctgctaaa
gcaggtatgttaggattcactaaatcattagctcttgaactagctaagacaggcgtaaca
gttaatgcaatttgcccagggtttattgaaacggaaatggtgatggcaattcctgaagat
gttcgtgcaaaaattgttgcgaaaattccaactcgtcgcttaggccacgctgaagaaatt
gcacgtggagttgtttacttagcaaaagacggcgcgtacattacaggacaacagttaaac
attaacggcggcttatacatgtaa

DBGET integrated database retrieval system