KEGG   Bacillus megaterium DSM 319: BMD_1216
Entry
BMD_1216          CDS       T01219                                 

Gene name
phaC
Definition
(GenBank) polyhydroxyalkanoic acid synthase, PhaC subunit
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_1216 (phaC)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BMD_1216 (phaC)
SSDB
Motif
Pfam: Abhydrolase_1 PhaC_N Hydrolase_4 PHB_depo_C Abhydrolase_5 DUF3141 DLH
Other DBs
NCBI-ProteinID: ADF38077
UniProt: D5DCX8
LinkDB
Position
1205735..1206823
AA seq 362 aa
MAIPYVQEWEKLIKSMPSEYKSSARRFKRAYEIMTTEAEPEVGLTPKEVIWKKNKAKLYR
YTPVKDNLHKTPILLVYALINKPYILDLTPGNSLVEYLLNRGFDVYLLDWGTPGLEDSNM
KLDDYIVDYIPKAAKKVLRTSKSPDLSVLGYCMGGTMTSIFAALNEDLPIKNLIFMTSPF
DFSDTGLYGAFLDDRYFNLDKAVDTFGNIPPEMIDFGNKMLKPITNFYGPYVTLVDRSEN
QRFVESWKLMQKWVADGIPFAGEAYRQWIRDFYQQNKLINGELEVRGRKVDLKNIKANIL
NIAASRDHIAMPHQVAALMDAVSSEDKEYKLLQTGHVSVVFGPKAVKETYPSIGDWLEKR
SK
NT seq 1089 nt   +upstreamnt  +downstreamnt
gtggcaattccttacgtgcaagagtgggaaaaattaatcaaatcaatgccaagtgaatat
aaaagttctgcaagacgttttaagcgtgcatatgaaattatgacaacagaagcggaaccg
gaagttggattaacaccaaaagaggttatttggaaaaagaacaaagcgaaattataccgc
tatacgccagtaaaagataacctgcataaaacaccaatcttactcgtatatgcattgatc
aataaaccgtatattttggatttaacacctggaaacagccttgttgaatacttattaaac
cgcggttttgacgtatatttgcttgactggggaactcctgggcttgaagacagcaatatg
aagctagatgattatattgtagattatattccaaaagcggcgaaaaaggtgctgcgcact
tctaaatctcctgatttgtctgtgcttggttactgcatgggcggaactatgacatctatt
tttgctgcattaaatgaagacttgccgattaaaaacttaatttttatgacaagtccattt
gatttttcggatacaggtttatacggagcattcctagacgatcgctactttaatttagat
aaagcagtagatacattcggaaacatccctccagagatgattgactttggaaacaagatg
ttaaagccaatcacgaatttctatggcccatatgtaacgttggtggaccgttcggaaaat
cagcggtttgttgagagctggaagctaatgcaaaagtgggttgctgacggaatcccattt
gctggtgaagcttatcgtcagtggattcgtgacttctatcaacaaaataaattaatcaat
ggtgaacttgaagttcgcggacgcaaagtagatttgaaaaatattaaagctaatatttta
aacattgctgctagccgtgatcatattgcgatgccgcatcaagtggcagctttaatggac
gctgtttcaagtgaagataaagagtacaaattgttgcaaacaggtcacgtatctgttgta
tttggtccaaaagcagtgaaggaaacatacccttcaatcggcgattggctagaaaaacgc
tctaaataa

DBGET integrated database retrieval system