KEGG   Bacillus megaterium DSM 319: BMD_1573
Entry
BMD_1573          CDS       T01219                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00051  Fructose and mannose metabolism
bmd02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMD_1573 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BMD_1573 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmd02000]
    BMD_1573 (levG)
Transporters [BR:bmd02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BMD_1573 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: ADF38431
UniProt: D5DC43
LinkDB
Position
1559487..1560314
AA seq 275 aa
MENEKRLTKKDIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKRLYGPGAQRNAALKR
HLEWFNTHPWISAPIFGVTAAMEEEMANKKDFDEKAISGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALGGNIAGPLLFFILINAIRLSTKYYGLKYGYLKGTEILKDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPVVVSRIKDDSGKVVVKTVQDVLDSILPGLLPLAL
TLLVAWMLRKGTNPLLIIFGIFLIGIGGYWIGFLG
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaatgaaaaaagattaacgaaaaaagatatctttagcatgttcattcgttcgaat
tttttacttggttcatttaactttgagcgtgttcaagcaatgggctactgttatgttatg
attccagcaatcaaacgcttatatggaccaggagctcagcgaaatgcagcattaaagcgt
cacttggaatggttcaatacacacccatggatttccgcacctatattcggcgtcacggca
gcaatggaagaagaaatggcaaacaaaaaagattttgatgaaaaagctatcagcggaatg
aaaattggattaatgggcccgcttgctggtgtaggagaccctattttctggggaacgctt
cgaccagttctcgcagccctaggcgcctcgcttgcgttaggcggtaatattgccggacca
ctgctgtttttcatcttaattaatgcaattcgattaagtacaaaatattatggattaaaa
tatggctacttaaaaggaacagaaattttaaaagatttagtaggcaatcgaattcaaaaa
ctgacggaaggtgcatccattttaggactcttcgtaatgggagcgttggtttcgaaatgg
accactattaatataccagtggttgtttctaggatcaaagatgattctggtaaagttgtg
gtaaaaaccgtgcaagacgtacttgatagtattctaccggggctgcttcctttagcactg
actctattagtagcatggatgcttcgaaaaggtacaaatccgctgcttattattttcggt
attttcttaattggtatagggggttattggataggctttttaggatga

DBGET integrated database retrieval system