KEGG   Bacillus megaterium DSM 319: BMD_2706
Entry
BMD_2706          CDS       T01219                                 

Definition
(GenBank) Acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00020  Citrate cycle (TCA cycle)
bmd00620  Pyruvate metabolism
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
Module
bmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMD_2706
   00620 Pyruvate metabolism
    BMD_2706
   00650 Butanoate metabolism
    BMD_2706
Enzymes [BR:bmd01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BMD_2706
SSDB
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Other DBs
NCBI-ProteinID: ADF39550
UniProt: D5DHJ0
LinkDB
Position
complement(2683375..2684889)
AA seq 504 aa
MENVCSRIKHEALQNRVVSAEEAASWIQDGMTLGLSGFTRAGDVKAVPFALAKRAETEPI
KVSVYTGASLGSDVDKLFAEKGMLNKRLPFQADPTMRKKINEGEFQFIDQHLSHTSEWVR
SGVLDSIDFAILEAISITDDGMMIPTTSIGNSMVFAEHAKSIIIEINTAQPELLEGIHDL
YDPGVQGQRDAIPLKKSDDRIGSLGIPIDLDKVKGIVFTNQLDSPSTVVAPDEETVVMAQ
NLISFLREEIKEGRLTESLAPLQSGIGSVANAVFHGLLDSEFHDLEVYSEVLQDAVFDLF
DAGKVTFASCCSITLSADKMEQVFSNFEAYRDKLILRPQEISNHPEIIRRLGLISINTAL
ELDIYGNVNSTHVMGTKMMNGIGGSGDFARNARLGIFVTKSIAKNGDISSIVPFVSHVDH
TEHDVDVIVTEQGYADLRGLAPRERAKRIIKNCAHPMYRDQLMAYYEEALTRGGQTPHVL
EKAFSFHTSYQKNGTMREAVAQTN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaaaacgtttgcagtcgaattaagcatgaagcactacagaatcgcgttgtctctgct
gaagaagcagcatcttggattcaagatggaatgacccttggtctaagcggttttacacgc
gcgggggatgtcaaagctgtaccgtttgcgctagcgaaacgagcggaaacagaaccgata
aaagtaagcgtgtataccggtgcttcacttgggtcagatgtggataagctatttgcagaa
aaaggcatgttaaataaacgcttgccgtttcaggcggaccctaccatgcgtaaaaaaatt
aatgaaggtgaatttcagtttattgatcagcatttatcgcatacttctgaatgggtacgt
tcaggcgtgttagattcaatcgatttcgctattttggaagcgatttctatcacagatgac
ggaatgatgattccaacaacgtcaattggcaattcgatggtgtttgccgagcatgcaaaa
tctattattattgaaattaacacagcgcagccagagctgttagaaggtattcacgatctg
tatgatccgggcgttcaaggacagcgagatgcaattcctttgaaaaaatctgatgatcgt
attggttcgttaggcataccaattgatttagataaagtaaagggtattgtatttacaaat
cagctagattcaccgtctacggttgtagcacctgacgaagaaacggttgtaatggctcaa
aatttgatttcatttttacgtgaagaaattaaagaagggcgattaactgaatcgcttgct
cctttacaatctggaattggatctgtggcaaatgccgttttccacggtttgttagattca
gagtttcatgatttagaggtgtattcagaagtattgcaggatgctgtgtttgatttattt
gacgcaggaaaagttacgtttgcttcctgctgctcaattacgctttcagcagataaaatg
gaacaagttttctctaattttgaagcctatcgagataagctcattcttcgcccgcaggaa
atttcaaaccatcccgaaatcattcgtcgcttaggactgatttctattaacactgcccta
gagctagacatttacggaaacgttaattccacgcatgtgatgggaacaaaaatgatgaac
ggaatcggaggctcaggagattttgcccgaaatgcgcgtctcggtatttttgtaacaaaa
tccattgctaaaaacggtgatatttcaagcatagtgccgtttgtttcgcacgttgatcat
acggaacacgatgttgatgtgattgtaacagagcaaggatacgcagacctgcgcggactc
gctccaagagaacgagcaaaacgaatcattaaaaattgtgcccatccaatgtatcgcgac
cagcttatggcgtattacgaagaagcgctcacgcgaggcggacaaacaccgcacgttctt
gaaaaagccttttcttttcatacgtcttatcaaaaaaatggaacaatgcgagaagctgta
gcgcaaacaaattga

DBGET integrated database retrieval system