KEGG   Bacillus megaterium DSM 319: BMD_2971Help
Entry
BMD_2971          CDS       T01219                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00030  Pentose phosphate pathway
bmd00680  Methane metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
bmd01230  Biosynthesis of amino acids
Module
bmd_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
bmd_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMD_2971 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    BMD_2971 (hxlA)
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BMD_2971 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase NanE HMGL-like His_biosynth DUF4571 Aldolase Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ADF39811
UniProt: D5DHX3
LinkDB All DBs
Position
complement(2945828..2946463)
Genome map
AA seq 211 aa AA seqDB search
MKIQLALDRVTIEEAIILAKLAEPSVDWIEVGTSLIKEYGIESIYKIKQAFPHKTIVADI
KTIDNAEYEFTMCYQAGADIATVMGVSPLPTIETCANVSEKWNKKMMVDLLNTSSSSQKQ
VSIYRNAIFCHHISKDEQEKEGKSLSQINLRQYFHSDAQIAAAGGINPASAASLLQMKAD
VAIIGSAITKSADVAKASAEFQDLFMSRGNV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacaattagcattagatcgcgtcacaattgaagaagctattatccttgccaag
ctggcagaaccctctgttgattggattgaagtaggtacatctcttataaaagagtatgga
attgaaagcatttataaaatcaaacaggcatttccgcacaagacgattgtagcagatatc
aaaacgattgataacgcagagtatgagtttacaatgtgctatcaagcaggagcagatata
gcaacagtcatgggtgtatcacctttacctacgatagagacgtgcgcaaatgtcagcgaa
aaatggaataaaaaaatgatggttgatttattaaacacgtcaagcagctcgcaaaagcaa
gtaagtatttatagaaatgctattttctgccatcatatcagcaaagatgagcaagaaaaa
gaaggaaaatcgctgagtcaaataaatttgcgtcagtattttcattcagatgcgcaaata
gcagcagcaggaggaattaatccagcctcagcagcatcattacttcaaatgaaagcggac
gttgcgattattggatcagcgattacaaaaagtgcggatgtggcaaaggcatctgctgaa
tttcaagacttatttatgagcagggggaacgtataa

DBGET integrated database retrieval system