KEGG   Bacillus megaterium DSM 319: BMD_3471Help
Entry
BMD_3471          CDS       T01219                                 

Definition
(GenBank) inosose dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00562  Inositol phosphate metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BMD_3471
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     BMD_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N DNA_photolyase UxuA NAPRTase_N
Motif
Other DBs
NCBI-ProteinID: ADF40311
UniProt: D5DIL0
LinkDB All DBs
Position
complement(3374793..3375686)
Genome map
AA seq 297 aa AA seqDB search
MGNENILWGIAPIGWRNDDIPEIGAENTLQHLLSDIVVAGFQGTEVGGFFPEPSILNKEL
ELRNLRIAGQWFSSFIIRDGIEETSNLFHKHCQYLQEVHADVAVVSEQTYSVQGIERNVF
TEKPYFSDQEWEALCAGLNELGKIAAEYGLRLVYHHHMGTGVQTLAEIDRLMDGTDANHV
YLLYDTGHIYVSDGDYMELLHKHIDRIKHVHFKDARRNVLEQCKKEGKSFLQSFLAGMFT
VPGDGCVDFTNVYKALVDYNYKGWIVVEAEQDPSIAHPLEYALMARKYINEKLVIHS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaaaatattctgtggggaattgctccaatcggctggagaaatgatgatatt
cctgaaattggtgcagaaaatacattgcagcatctgttaagcgatatcgttgtagcaggc
tttcaaggaacggaagtgggaggtttttttcctgaaccaagcatattaaacaaagagctt
gagctacgaaatttaagaattgcaggtcaatggtttagcagttttatcattcgtgatggg
atagaggagacgtcaaatttatttcacaaacattgtcagtatctgcaggaagtgcatgct
gatgtggcggtcgtatctgagcaaacttacagtgttcaagggattgaaagaaatgttttt
actgaaaaaccttatttcagtgatcaagaatgggaagctttatgtgcagggttaaatgag
ctgggaaaaatcgcagcagaatacggtttacgtcttgtctatcatcaccatatgggaaca
ggtgtacaaacattagctgaaattgatcggctaatggacggaaccgacgcaaatcatgtt
tatcttctatatgatacgggacatatttacgtttctgacggagactatatggagctatta
cataaacatatagatcgtattaaacacgttcattttaaggatgcaagaagaaacgtgctg
gagcagtgcaaaaaagaaggaaagtcatttttgcagtcgtttctagccggtatgtttacc
gtgccgggtgatggatgtgtagattttacaaacgtgtataaagcgttagttgattacaat
tacaaaggatggattgtggttgaggcggaacaggacccttctattgcgcatccattagaa
tatgctttaatggcccgaaagtacattaacgaaaagttagttattcattcttaa

DBGET integrated database retrieval system