KEGG   Bacillus megaterium DSM 319: BMD_4427
Entry
BMD_4427          CDS       T01219                                 

Gene name
buk
Definition
(GenBank) butyrate kinase
  KO
K00929  butyrate kinase [EC:2.7.2.7]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_4427 (buk)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.7  butyrate kinase
     BMD_4427 (buk)
SSDB
Motif
Pfam: Acetate_kinase PilM_2 BcrAD_BadFG ROK IceA2
Other DBs
NCBI-ProteinID: ADF41257
UniProt: D5DLC9
LinkDB
Position
complement(4280759..4281844)
AA seq 361 aa
MDMHEYRMLIINPGSTSTKIGVFHNDKPIFDRTIRYDSQQMNQFETIYGQYEFRKNSILE
ALDEEGINLSKLSAVCGRGGLLRPIEGGTYEVNQAMLKDLKDGYAGHHASNLGGILAFEI
ASGLNIPAYIVDPVVVDELSDIARISGTPFMERKSIFHALNQKSVARKVAKEMNSTYEQM
NVIVTHMGGGITVGVHQRGKVIDVNNGLHGDGPFSPERAGGVPVGELVRLCFSGQYYREE
IMKMLVGKGGLVGYLGTSDVQKVEALVKNGNEKAKLIYEAMAYQISKEIGAASTVLHGKV
DAIILTGGIAYSKAFVELIINHVKWIADVIVYPGENELQALAEGALRVLTGEEEVKEYKG
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
ttggatatgcacgaatatcgaatgctgataataaatccgggttcaacgtctacaaaaatt
ggcgtgtttcacaacgataaaccaatttttgatcgaacaatccgctacgattcacagcaa
atgaatcagtttgagacgatatatggacagtatgagttccgtaaaaactcgattttagag
gcacttgatgaagaagggattaatttatctaaattaagtgcagtatgtggaagaggaggg
cttttacgcccgattgaaggcggcacatatgaagtaaatcaagccatgctcaaagattta
aaagacggttatgccggccatcatgcttcaaatttaggcgggattttagcttttgagatt
gcgtctggattaaatataccagcgtacattgttgatccagtggtggtagatgagctaagt
gacatcgctcgtatctcaggaactccttttatggaaaggaaaagcatctttcacgcgctg
aatcaaaaatcggttgctcgaaaagtggctaaagaaatgaatagcacatatgaacaaatg
aacgttattgttacccatatgggtggaggcattacagtcggagttcatcaacgcggaaaa
gtaattgatgtgaacaatggcctgcacggtgacggtccttttagtccagagcgcgctggt
ggtgtaccggttggtgaattagttcgtctttgcttttcaggtcagtattaccgcgaggag
attatgaaaatgcttgtaggaaaaggcgggcttgtcggttatttgggcacatctgacgtg
cagaaagtcgaagcgctagtgaaaaatggaaacgaaaaagctaagcttatctatgaagca
atggcttatcaaatttcgaaggaaattggagctgccagtacggtattgcatggaaaagta
gatgccattattttaacaggaggcattgcttattcaaaagcgtttgttgagctgattatt
aatcatgtaaagtggattgcagatgtcattgtttatcctggagaaaatgagcttcaagcg
ctagctgaaggggctctccgagtgcttacaggtgaagaagaagtgaaggaatataaaggc
gcttaa

DBGET integrated database retrieval system