KEGG   Bacillus megaterium DSM 319: BMD_4429
Entry
BMD_4429          CDS       T01219                                 

Gene name
ptb
Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_4429 (ptb)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BMD_4429 (ptb)
SSDB
Motif
Pfam: PTA_PTB Pox_J1
Other DBs
NCBI-ProteinID: ADF41259
UniProt: D5DLD1
LinkDB
Position
complement(4283051..4283962)
AA seq 303 aa
MTLATILSRVAKQSSLTVAIAAAEDLETIEAVYEAVSREVSEFILFGNETTINELFRQYR
PSLLTHKAVTVVHTESVLEAAQLAVRSVQQGQAHIVMKGNLSTSLILKAVLNKEHGLRTG
NVLSHVAVFDVPHYDRPILVTDAAMNITPSLEEKVQIIQNAVNVAHSIGIEMPKVAPIAA
VEVVNPLMPATVEAALLTQMNRRGQIKGCVIDGPLALDNAINIEAAKQKGIQSEVAGQAD
ILLVPAIETGNVLYKSLIYFAKAKVGAILAGAKAPVVLTSRADSSESKLYSLALAISVAQ
QNS
NT seq 912 nt   +upstreamnt  +downstreamnt
atgactcttgctaccatcttatctcgggttgctaagcagtcttctttgactgttgccatt
gctgcagctgaagacttagaaacaattgaggcagtgtatgaagctgtgtcaagggaagtt
tctgaatttattttgtttggcaacgaaacgacaattaatgaattattcaggcagtaccgc
ccatccttactcactcataaggctgtgacggtcgtacatacggagtccgttttagaagcg
gctcaattggctgtgcgttcagttcagcaaggtcaagctcatatcgtaatgaaagggaat
ttatccacatcgcttattttaaaagctgtgttaaataaagagcatggtttgcgtacggga
aatgttttatcacatgtagctgtatttgacgttcctcactatgatcgtccgattcttgta
acagatgcagctatgaatattacgccgtctctggaagagaaagttcaaatcattcaaaat
gcggtgaacgttgcccactcgattgggatcgagatgccaaaggtagctcctattgcagcg
gttgaagttgtgaaccctttgatgcctgcaacagtagaggctgcacttcttacacagatg
aaccgcagaggacaaattaaaggctgcgttattgatggacctttagcactcgacaatgcc
attaacatagaagcagccaagcaaaaaggcattcaaagtgaagttgccggtcaagcagat
atattactcgttccagcaattgaaacagggaacgtcttatataaatccctcatttatttt
gctaaagcaaaagttggagctattctagcaggagcaaaagctccggtcgtcttaacatcc
agagcagattcatcagaaagtaaattatactcactggcgcttgctatcagcgtcgctcaa
cagaattcttag

DBGET integrated database retrieval system