KEGG   Bacillus megaterium DSM 319: BMD_4625Help
Entry
BMD_4625          CDS       T01219                                 

Gene name
yajC
Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02024  Quorum sensing
bmd03060  Protein export
bmd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BMD_4625 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMD_4625 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMD_4625 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmd02044]
    BMD_4625 (yajC)
Secretion system [BR:bmd02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BMD_4625 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 Holin_BhlA T2SSM
Motif
Other DBs
NCBI-ProteinID: ADF41449
UniProt: D5DLH3
LinkDB All DBs
Position
complement(4462684..4462947)
Genome map
AA seq 87 aa AA seqDB search
MGVLQNIWPLLLMFVIFYFLLIRPQQKRQKNVQQMQSALKKGDKVVTIGGMHGLVDAIDE
SQVVVRSTDGSKLTFDRNAIREVRSVD
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttttacaaaatatttggccattacttttaatgtttgtcattttctatttcttg
ttaatccgtccacagcaaaaacgtcaaaaaaacgtacagcaaatgcaatcagcacttaaa
aaaggtgataaggttgttacaattggcggtatgcacggtttggtagacgcaatcgatgag
tcacaagttgtggttcgcagcactgacggttcaaaattaacgtttgaccgcaatgctatt
cgtgaagtaagaagcgtagattaa

DBGET integrated database retrieval system