KEGG   Bacillus megaterium DSM 319: BMD_4709Help
Entry
BMD_4709          CDS       T01219                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00020  Citrate cycle (TCA cycle)
bmd00190  Oxidative phosphorylation
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
Module
bmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMD_4709 (sdhB)
   00650 Butanoate metabolism
    BMD_4709 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMD_4709 (sdhB)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMD_4709 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BMD_4709 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_20 Fer4_2 Fer4 Fer4_18 Fer4_13 Fer4_4 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADF41532
UniProt: D5DLQ6
LinkDB All DBs
Position
complement(4544882..4545655)
Genome map
AA seq 257 aa AA seqDB search
MSEQQTVQKTVRFIITRQDSAESAPYNQEFEIPYRPNMNVISALMEIRRNPVDASGKEVA
PINWEMNCLEEVCGACSMVINGKPRQSCTALVDKLEQPIRLQPMKTFPVVRDLQVDRSRM
FDSLKKVKAWVPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNDKSNFIG
PAPLSQVRLFNAHPTGALNKGERLETIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALN
RDTTIQAFRSFFGSDQV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaacaaacagtccaaaagacagtgcgcttcattattacacgtcaagattca
gctgaatctgctccttacaatcaggagtttgaaattccgtatcgtccgaatatgaacgtt
atttcagcactgatggaaatcagacgtaaccccgttgatgcttcaggtaaagaggttgct
ccgataaactgggaaatgaactgtttagaggaagtatgcggagcctgttcaatggtcatc
aacggtaaacctcgtcagtcatgtacagctcttgttgataaactagaacagccaattcgc
ttacagccaatgaaaacatttcctgtggttcgtgatttgcaagtagaccgtagccgtatg
tttgattcactaaaaaaagtaaaagcctgggttccaatcgatggcacatacgatttaggt
ccaggaccgcgtatgcctgaaaagaaacgtcagtgggcgtatgagttatccaaatgtatg
acatgtggcgtttgcttagaagcttgtccaaatgtaaacgacaagtcaaacttcatcggt
ccagcaccgctttctcaagttcgcctgtttaatgcccatccaaccggtgcgttaaataaa
ggagaacgtttagagacgattatgggtgatggaggactagcgaactgcgggaattctcaa
aactgcgttcaatcatgcccaaaaggaattccattgactacttcaattgcagctttgaac
cgcgatacaacaattcaagcattcagaagtttctttggtagcgatcaagtataa

DBGET integrated database retrieval system