KEGG   Bacillus megaterium DSM 319: BMD_4710Help
Entry
BMD_4710          CDS       T01219                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00020  Citrate cycle (TCA cycle)
bmd00190  Oxidative phosphorylation
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
Module
bmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMD_4710 (sdhA)
   00650 Butanoate metabolism
    BMD_4710 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMD_4710 (sdhA)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMD_4710 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BMD_4710 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA Pyr_redox FAD_oxidored NAD_binding_8 RNase_H_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADF41533
UniProt: D5DLQ7
LinkDB All DBs
Position
complement(4545659..4547446)
Genome map
AA seq 595 aa AA seqDB search
MSNGKIIVVGGGLAGLMATIKIAESGKQVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERSCRGISAQNLK
SMEIKTFPADAVIMATGGPGIVFGKSTNSVINTGSAASIVYQQGAYYSNGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVAQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKVPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPKAVEYINGLEKSADAI
SSSVYDRHVKEEEEKWNNIMNLQGTENAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQ
ELIERYDRININDTAKWSNQAATFTRQLQNMLQLSRVVTLGAYNRNESRGAHYKPDFPDR
NDEEFLKTTMAAFVDKKTAPSFHYEEVDVSLIKPRKRDYTKKKDEKPKKQQEGVR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggaaaaatcatcgtagtcggtggcggtttagctggcttgatggcaacaata
aaaattgctgagtctggcaagcaagtagatttattttcactagttccggtaaaaagatct
cactcagtttgcgcgcaaggtggaatcaacggagccgtaaacacgaaaggtgaaggggat
tcaccatgggaacactttgatgacacagtgtacggcggagactttttagccaaccagcca
cctgtaaaagcaatgtgtgaagcagctcctggtattattcacctacttgaccgcatgggt
gttatgtttaaccgtactcctgagggtttgttagacttcagacgatttggcgggacgcag
catcaccgtacggcttttgctggagcaacaacgggtcaacaattattgtacgcattagat
gagcaggttcgtcgctatgaagttgccggacttgtgacaaagtacgaaggatgggaattc
ttaggtgctgttcttgacgatgagcgcagctgtcgcggaatttctgcacagaatttaaaa
tcaatggaaattaaaacgttcccagctgacgcggttattatggctacaggtggacctgga
attgtttttggaaaatcgacgaactcagttattaatacaggttcagcggcatctatcgtg
tatcagcaaggtgcatactattcaaacggagagtttattcaaattcatccaactgctatc
ccaggagatgataagcttcgtcttatgagtgaatctgctcgtggagaaggcggacgcgtt
tggacatataaagacggtaaaccttggtatttcttagaggaaaaatatcctgcatacggt
aacttagtacctcgtgatattgcaactcgtgaaatttttgacgtctgcgtagcgcagaag
ttaggaatcaacggagagaacatggtttatctggacctttcacataaagatccaaaagag
ctagacattaaacttggaggcatcatcgaaatctatgaaaaattcatgggcgatgatccg
cgcaaggtaccaatgaaaattttcccagccgtacactattcaatgggcggtttatgggtg
gattacgatcaaatgacaaatattcctggcttattcgcagctggtgagtgtgattattca
cagcacggagcgaaccgtttaggagcaaactcattattatcagctatttatggtggtatg
gttgccggtcctaaagcggttgaatacatcaatggtttagaaaagagcgcagatgctatt
tcttcaagcgtatatgatcgtcatgtgaaagaagaagaagagaaatggaacaatatcatg
aatcttcaaggtacagaaaatgcatacgttcttcataaagagctaggggaatggatgact
gacaacgtgacagtcgtacgatacaatgacaaactgttaaaaacagatgaaaagattcaa
gaattaattgaacgctatgatcgtattaacattaatgatacagctaaatggagtaatcaa
gcggcaacatttactcgtcagctgcaaaacatgcttcagctttcacgtgttgtaacgcta
ggagcttacaaccgtaacgaaagtcgcggtgctcattataagccagatttcccagatcgt
aacgatgaagaattcttaaaaacaacaatggcagcttttgtggataagaaaacggctcct
tctttccattatgaagaggtagacgtatcgttaattaaaccgcgtaagcgcgactacaca
aagaaaaaagatgaaaaaccaaaaaaacaacaagagggggttcgttaa

DBGET integrated database retrieval system