KEGG   Bacillus megaterium DSM 319: BMD_4755Help
Entry
BMD_4755          CDS       T01219                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00020  Citrate cycle (TCA cycle)
bmd00480  Glutathione metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
bmd01210  2-Oxocarboxylic acid metabolism
bmd01230  Biosynthesis of amino acids
Module
bmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMD_4755 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMD_4755 (icd)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BMD_4755 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADF41578
UniProt: D5DMW1
LinkDB All DBs
Position
complement(4594031..4595317)
Genome map
AA seq 428 aa AA seqDB search
MTKGEQISVANGVLNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVAKAYNGEKEIVWKE
VLAGEKAFNQTGEWLPEETLDAIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFDGVPSPIKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLVSFLQTELGVNKIR
FPETSGLGIKPISSEGTERLVRAAINYAIEQGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EKEFGDKVFTWAQYDRIVEKEGAQAANKAQAEAEAAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLMLEHLGWNEAADLIMKSMEKTIASKVVTYDFARLMDGATEVKCSEFADELIS
NLGKQVTV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggtgaacaaatttctgtagcaaacggcgtgttaaacgtaccaaataaccca
attattccatttatcgaaggtgacggaattggtccggatatctgggcagcagcttctcgc
gtattagaagcagcggttgcaaaagcatacaatggtgaaaaagaaatcgtttggaaagaa
gtattagcaggtgaaaaagcatttaatcaaactggcgaatggttaccggaagaaacgtta
gatgcaattcgcgaatacataattgcaatcaaaggaccattaacaacaccagtaggcggt
ggaattcgttctctaaacgtggcattgcgtcaagaattagacttattcacatgcttacgt
cctgttcgctactttgacggcgtaccttctccaattaagcgccctgaagatacagatatg
gttattttccgtgaaaataccgaagatatttatgctggtattgaatatgcgaagggttct
gaagaagtacaaaagcttgtttcattcctacaaacggaattaggcgtaaataaaatccgt
ttccctgaaacttctggattaggtattaagcctatttcttctgaaggaacagagcgtctt
gtgcgtgcagcaatcaactatgcaattgaacaaggccgcaagtctgttacgcttgtacac
aaaggtaacattatgaaatatacagaaggcgcatttaaaaattggggctatgagctagct
gaaaaagaattcggcgataaagtatttacttgggctcaatatgaccgcatcgttgaaaaa
gaaggtgcacaggctgcaaacaaagctcaagcagaagcggaagcagcaggaaaaattatt
gtaaaagattcaattgcagatatcttcttacaacaaattttaactcgtccacgtgaattc
gatgtagtagcaacaatgaatttaaatggagattacatttcagatgcattagcagcacaa
gttggtggtatcggaattgctccaggagcaaacatcaactatgaaactggacatgctatc
tttgaagcaactcacggtacagcacctaaatatgctggtttagataaagtaaacccatct
tctgtattattatcaggtgtgttaatgcttgaacaccttggctggaacgaagcagcggat
ttaatcatgaaatcaatggaaaaaacaattgcttcaaaagtagtaacatatgatttcgca
cgtttaatggatggtgcaacagaagtgaagtgttcagagttcgctgatgaattaattagc
aatctaggaaaacaagtaacagtttaa

DBGET integrated database retrieval system