KEGG   Bacillus megaterium DSM 319: BMD_4964Help
Entry
BMD_4964          CDS       T01219                                 

Gene name
cotS
Definition
(GenBank) spore coat protein S
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADF41764
UniProt: D5DM09
LinkDB All DBs
Position
complement(4782734..4783735)
Genome map
AA seq 333 aa AA seqDB search
MIQTIYEHYGLRPNEFMPVGKFEGFQYRDILYTIINVKQMEQDELNELYQMSQFLMGQGD
RHVATFMPNLNGEMITETETEKFIICRCLAEEKNPNFSPGHELAVFHQKGRLFPYEVEKA
NRLGQWKSMWEKRLDQMEQFWYGRLRALPNQEMEKRFLETFPYYLGLTENAIQYLVDTEI
DDLPRSIDAATICHHRFGQKTWGEDYVYKLPADWVFDHPSRDIAEYIREQYLLTYAVDER
HMHQFLSEYEKVNPLSSFSWRLLYARLLFPVHYFEVIEGYYSVQDERQKQKYYEKLEGVL
AHSSHYEAFLKRFYQSVGISTSRYHIPELTWIH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaccatttatgagcattacggattacgtccaaatgaatttatgcccgtaggt
aaatttgaaggttttcagtatcgagatattttatatacaatcattaatgtaaaacaaatg
gaacaagacgagttaaatgaactatatcaaatgagtcaatttctgatgggccaaggtgat
cgccatgtggcaacatttatgcctaatttgaatggtgaaatgattacagaaactgaaact
gaaaaatttattatttgccgctgtcttgcggaagagaaaaaccccaacttttcacctggg
cacgagctagctgtttttcatcaaaaagggagactgtttccttatgaagtggaaaaagca
aaccggctagggcaatggaagtccatgtgggagaagcgtctcgaccagatggagcaattt
tggtatggaagattacgtgctttgcctaatcaagagatggaaaaacgttttttagaaact
tttccttattacctaggattaacggaaaatgctattcaatacctagtagacacggaaatt
gacgatttgcctcgttcaattgacgctgcgacgatttgtcatcatcggttcgggcaaaaa
acatggggggaagactacgtttataagctcccagcagattgggtcttcgatcatccgagc
agagatatagctgaatatataagggaacaatatttattaacatacgctgtcgatgaaagg
cacatgcatcagtttttaagtgaatacgaaaaggtaaacccgctttcttctttttcatgg
agactgttatatgctagacttctttttcccgttcattattttgaggtcattgaagggtat
tacagtgtacaagatgagaggcaaaaacaaaagtattatgagaagctggaaggagtatta
gctcattcttctcactacgaagcttttctgaagcgcttttaccagtcggtgggtatttca
acgtctcgttatcacattcctgaattaacatggattcattaa

DBGET integrated database retrieval system