KEGG   Bacillus megaterium DSM 319: BMD_4991Help
Entry
BMD_4991          CDS       T01219                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00071  Fatty acid degradation
bmd00280  Valine, leucine and isoleucine degradation
bmd00281  Geraniol degradation
bmd00362  Benzoate degradation
bmd00592  alpha-Linolenic acid metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01212  Fatty acid metabolism
Module
bmd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMD_4991 (fadA)
   00592 alpha-Linolenic acid metabolism
    BMD_4991 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMD_4991 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BMD_4991 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_4991 (fadA)
   00642 Ethylbenzene degradation
    BMD_4991 (fadA)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BMD_4991 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADF41791
UniProt: D5DM36
LinkDB All DBs
Position
complement(4805038..4806216)
Genome map
AA seq 392 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLASVRPDDLGAIAVKETLRRAGGYEGPIDDLIIGCAMPE
AEQGLNMARNIGALAGLPYTVPAITINRYCSSGLQSIAYGAERIMLGQAKAVLAGGAESM
SFVPMFGNVARPNVQLVENAPEYYMGMGHTAEQVAMKYGISREDQDAFAVRSHQKAAKAL
QEGKFNDEIVPVEVTLRKVDENNKLREQKLMFSQDEGVRPGTTADVLGKLRPAFSVKGSV
TAGNSSQTSDGAASVFLMDKEQAEAEGLKPLLKFRSFAVGGVPPEVMGIGPVAAIPKALK
LAGLELSDIGLFELNEAFASQALGVIRELNINEDKVNVNGGAIALGHPLGCTGAKLTLSL
MHEMQRRNEQFGIVTMCIGGGMGAAGVFELLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagttattgtagcaggtgctaggacaccggttggaaaagcaaaaaaaggt
tcactggcaagtgttagacctgatgatttgggagccattgcggttaaagaaactcttcgc
cgagcaggcggatacgaaggaccaattgatgatttaattattggttgtgcgatgcctgaa
gcggaacaaggtttgaatatggctcgaaatattggcgctcttgcgggtttgccttatacg
gtgccagcaataacgattaatcgttattgttcatcaggtttgcaaagtattgcctacggt
gcagaacgaattatgctagggcaagccaaagcagtgttagctggaggagcagaatcaatg
agttttgttccgatgtttggaaatgtagcgcgtccgaatgttcagctggttgaaaatgcg
ccggagtattatatgggcatgggacatacagcagaacaagtggcgatgaaatatggaatt
tcacgtgaagaccaggatgcgtttgctgtacgcagccatcaaaaagcagcaaaagcactt
caagaagggaagtttaacgacgaaattgttccggtggaagtgacgcttcgaaaagtggat
gaaaacaataagctccgtgaacaaaagctgatgttctctcaagatgaaggagttcgtcct
ggcacaactgcggatgtattagggaaacttcgtccagctttttcggttaaaggatccgta
acagctggaaactcttcgcagacaagtgacggagctgcatccgtttttctaatggataaa
gaacaagctgaagcagaagggttaaagcctttgcttaagtttcgctcatttgcagttgga
ggtgttccgcctgaagtaatggggattggcccggtagcagccatacctaaagctcttaaa
ctagcagggctggagctttctgatattggactgtttgaattaaatgaagcatttgcttct
caagcacttggcgttattcgtgaattaaatattaatgaagataaagtaaatgtaaacgga
ggcgctattgctttaggtcatccattaggctgtaccggagctaagctgactcttagctta
atgcacgaaatgcagcgtcgaaatgagcagtttggtattgtcaccatgtgtattggcgga
ggaatgggagctgctggtgtatttgaattgttagcataa

DBGET integrated database retrieval system