KEGG   Bacillus megaterium DSM 319: BMD_4992
Entry
BMD_4992          CDS       T01219                                 

Gene name
fadN
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase/isomerase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00071  Fatty acid degradation
bmd00362  Benzoate degradation
bmd00650  Butanoate metabolism
bmd01100  Metabolic pathways
bmd01120  Microbial metabolism in diverse environments
bmd01200  Carbon metabolism
bmd01212  Fatty acid metabolism
Module
bmd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_4992 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMD_4992 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_4992 (fadN)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BMD_4992 (fadN)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Other DBs
NCBI-ProteinID: ADF41792
UniProt: D5DN65
LinkDB
Position
complement(4806229..4808607)
AA seq 792 aa
MNIKKAAVLGSGVMGSGIAAHLANVGIPTLLLDVVPTSLTADEEKKQLTLKDRQVRNRLS
TTALAKLTKQKPAPLTSKSSLSLITPGNLEDHSQQLSECDWIIEVVVERLDIKQQLFERI
DSVRKKGSIVSSNTSGISIHEMAKGRSEDFKAHFLGTHFFNPPRYLKLLEIIPTHDTKSE
IVEYMKTFGEEVLGKGVVIAKDTPNFIANRIGTYGLLVTVQEMLKGNYSVGEVDSVTGPL
IGRPKSATFRTLDVVGLDTFIHVANNVFDKVEGKEKEVFDVPLFMKQMQENGWLGSKSGQ
GFFLKKGKEILELDPSTLQYVERKKLKTASTELSKQAKGLQNKMKALIYSSDRAGQLLWN
VISPVLVYAAQLKNEIADDIVAIDQAMKWGFGWKMGPFETWDAIGLEKSIEKMEQSGLAV
PQWVKQMQENGFTSFYKEMEGQTLYYEDEEYKAVKENKKVIHLSSLRSQNNVILENSGAS
LIDLGDDVACLQFTSPNNAIGLDIISLLNQSLEEVNKNYKGLVIGNQGKNFCVGANLAMI
LMEAQDDNYFEIEFVIKQFQQAMMKVKYNEKPVVAAPFAMTLGGGAEICLPSAKIQASAE
TYMGLVEVGVGLIPGGGGNKELYIKQLNGLPNGVTLDLQQIANKTFETIATAKVSASAAE
ARQLNFLNRHDGISVNGDHLLNDAKNSVLALHDTGYRPPVRTKIPVVGETGYATLLLGAQ
SMKYSGYISEHDYKIASKLAFVLAGGRVAFGSEVDEEYLLDLEREAFLSLVGEAKSQERM
QHMLVKGKPLRN
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgaacataaaaaaagccgccgttttaggttcaggagttatgggctctggaattgcagct
catttagcaaatgtaggaattccaacgcttttgctagacgtggttccaacttcattaaca
gcagacgaggaaaaaaaacagctaacgcttaaagataggcaagtgagaaatcggttgagt
acaactgctctagctaaattaacgaagcaaaaaccggcacctttaacgtcgaagtcatca
ctatcgttaattacgccaggaaatcttgaagatcattcacagcagttaagcgagtgtgat
tggattattgaagtagtagtggaacgtcttgatattaaacagcagttgtttgaaagaatt
gacagtgtacgaaaaaaaggaagtatcgtaagttcaaatacttcaggaatatcgatccac
gaaatggctaaaggacgctcagaagattttaaagcgcattttttaggaacgcactttttt
aatccaccgcgttatttaaagttattagaaatcattccaactcatgacacaaaatcagaa
attgttgaatatatgaaaacgtttggtgaagaggtattaggtaaaggagtagttattgca
aaagatacgcctaactttatcgccaaccgtatcggtacgtacggtttacttgtgactgtt
caagaaatgttaaaaggcaattacagcgtgggagaagttgactctgtgacgggcccctta
attggaagaccaaaaagcgcaacgtttcgaacactagacgtagtgggtctagacacattt
attcatgtggccaataatgtatttgacaaagtagaaggcaaagaaaaagaagtgttcgat
gtccctttatttatgaaacaaatgcaggaaaatggctggctgggaagcaagtcagggcaa
ggcttctttttgaagaaaggcaaggaaattttggaacttgatcctagtacacttcaatac
gtcgagagaaagaagttaaaaacagcttctaccgaattaagcaagcaggcaaaagggctg
caaaataaaatgaaagcgcttatatattcgagtgatcgtgccggccagcttctttggaat
gtgatcagtcccgttcttgtatatgcagcacagttaaaaaatgaaatagccgacgatatc
gtggccattgatcaagctatgaagtggggatttggctggaaaatgggtccttttgagacg
tgggatgcaattggtttagaaaagtcaattgagaagatggagcagtctggtttagcagtt
ccgcaatgggtaaaacaaatgcaggaaaatggatttacaagcttctataaagaaatggaa
ggtcaaacgctttactacgaagatgaggagtataaagcagtaaaagaaaataaaaaggta
attcacctgtcatctttacgttctcaaaataatgtcattttggaaaacagcggagcgagt
ttaattgatttaggagatgatgtggcgtgcctgcagttcacctctcctaacaatgcaatt
gggctagatattattagcttattaaatcagtctcttgaagaagtgaataagaactataaa
ggcctggtcataggaaatcaagggaaaaatttctgcgttggcgctaacttagccatgatt
ttaatggaagcgcaagatgacaattattttgaaattgaatttgttattaaacaatttcaa
caggcaatgatgaaggtgaaatataatgaaaagccggttgttgcagctccatttgctatg
actcttggaggcggagcagaaatttgcttaccgtcagctaaaattcaagcttctgctgaa
acttacatgggccttgtagaagtaggagtcggactcattcctggtggaggaggtaataag
gagctttatatcaaacagctgaatggtttacctaacggtgtaacgctcgatcttcagcaa
attgccaataaaacatttgaaacaattgctactgcaaaagtatctgcctctgctgcagaa
gctagacagctaaactttttaaaccgccatgatggcatcagcgtaaacggagatcacttg
ctgaatgatgcgaagaactcagtccttgctttacatgacacgggctatagaccgcctgta
agaactaagattcctgtggttggagaaacaggatatgcaacgttactgctaggagctcaa
tccatgaagtattcaggatatatatcagaacatgattataaaattgctagtaagttagca
tttgtgttagccggaggacgtgtagcgtttggttcggaagttgatgaagagtatttgctg
gacttagagagagaagcatttttaagccttgttggagaagcgaagtctcaagaacgtatg
cagcacatgttagttaaaggaaaaccactgcgtaattaa

DBGET integrated database retrieval system