KEGG   Bacillus megaterium DSM 319: BMD_5102Help
Entry
BMD_5102          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-UBR DUF4428 zinc-ribbons_6 DZR zf-C4pol Cytochrom_CIII AbiEi_4 HTH_17 zinc-ribbon_6
Motif
Other DBs
NCBI-ProteinID: ADF41901
UniProt: D5DNH4
LinkDB All DBs
Position
complement(4916675..4917088)
Genome map
AA seq 137 aa AA seqDB search
MGTLDNCRECGHLFVKSGSINICKSCFDKEEALFQRVSSFLKKRANRTATTYEVMKETGV
SDSLIHQFIRQGRLVLTNFPNISYPCMQCNAQIREGKLCHSCSQEIKHELEKHNREMIRS
NEEATRPTYRSNERKKE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgttagataattgcagggaatgcggtcatttatttgtaaaaagtggatcaata
aacatatgtaaatcatgttttgacaaagaagaagctctgtttcaacgtgtttcttcgttc
ttgaagaagagagcaaatcgtacagcaacgacttacgaagtgatgaaagaaacgggcgtt
tcagattcgttaattcatcaatttattcgacaaggtcgcttagtgctaactaattttccg
aatataagctatccatgcatgcaatgcaacgctcagattcgagaaggtaaactttgtcat
tcatgttctcaagaaattaaacatgagttagaaaagcataatcgtgagatgattcgttca
aatgaagaggcgacgcgtcccacctatcgttctaacgaaaggaaaaaagagtaa

DBGET integrated database retrieval system