KEGG   Bacillus megaterium DSM 319: BMD_5134Help
Entry
BMD_5134          CDS       T01219                                 

Gene name
atpD
Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00190  Oxidative phosphorylation
bmd01100  Metabolic pathways
Module
bmd_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMD_5134 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bmd00194]
    BMD_5134 (atpD)
Enzymes [BR:bmd01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BMD_5134 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BMD_5134 (atpD)
Photosynthesis proteins [BR:bmd00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BMD_5134 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase AAA_19 NB-ARC T3SS_ATPase_C AAA ABC_tran NACHT AAA_7 ATPase_2 AAA_16 RNA_helicase ATPase AAA_22 LPD3 TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: ADF41933
UniProt: D5DM49
LinkDB All DBs
Position
complement(4950555..4951976)
Genome map
AA seq 473 aa AA seqDB search
MTKGRVTQIMGPVVDVKFDNGHLPAIYNALKISHKPSSASEVAIELTLEVAIHLGDNTVR
TVAMSSTDGLVRGLEVEDTGAAISVPVGDVTLGRVFNVLGEKIDLDAPIDAGARRDPIHR
QAPKFENLSTQAEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHG
GISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEYFR
DEQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTSVGSV
TSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVG
EEHYAIARQVQQTLQRYKELQDIIAILGMDELSDEDKLVVQRARRVQFFLSQNFHVAEQF
TGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGRIEEVIENAKRMGVEV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggacgcgttactcaaatcatgggtccagttgtagacgtaaagtttgacaac
ggacaccttccggcaatttataacgcccttaaaatttcacataaaccgagcagtgcaagt
gaagttgcaatcgaattaacattagaagttgcgattcacttaggtgataacacagttcgt
acagtagcaatgtcatccactgacggcttagttcgtggattagaagtagaagatacaggt
gcagcaatctcagtaccagttggtgacgttacgttaggtcgtgtatttaacgtattaggt
gaaaaaatcgacttagacgccccaatcgatgcaggtgcacgtcgtgatccaatccaccgt
caagcaccaaagttcgaaaatctatctacacaagctgaaattcttgaaacaggtattaaa
gtagtagacttattagctccttacattaaaggtggaaaaatcggtctattcggtggtgcc
ggtgtaggtaaaacagtattgattcaagaattaatcaataacattgctcaagagcacggc
ggtatttcagtattcgctggtgtaggtgagcgtacgcgtgaaggtaatgacttataccat
gaaatgacagattctggtgttattaagaagacggctatggtatttggacaaatgaatgag
ccacctggtgcacgtcaacgtgttgcattaacaggattaacaatggcagaatacttccgt
gatgaacaaggtcaagacgtattattctttattgataatatcttccgtttcacacaagcg
ggttcagaagtatcagcattacttggccgtatgccatcagcagtaggttatcagccaaca
ttagcgacagaaatgggtcagcttcaagagcgtattacatcaacaagcgtaggttctgta
acatcgattcaagcgatttacgtaccagccgatgactatacggatccagctccagcgaca
acatttgctcacttagatgcaacaacaaacttagagcgtaaattatcagagatgggtatt
taccctgcggtagatccattagcatctacatctcgcgctttatctcctgaaattgttgga
gaagagcactatgcaattgcgcgtcaagttcaacaaacgttacagcgttataaagagtta
caagatatcattgcaatcctaggtatggatgagttatctgatgaagataaacttgttgta
caacgtgctcgtcgcgttcaattcttcttatctcaaaacttccacgtagcagaacaattt
acaggtcaaaaaggttcttatgttcctgtaaaagaaactgttaaaggatttaaagagatc
ttggaaggtaaatacgatcatttacctgaagatgcgttccgtttagttggtcgcattgaa
gaagttattgaaaatgcgaaacgtatgggagtagaagtttaa

DBGET integrated database retrieval system