KEGG   Bacillus megaterium DSM 319: BMD_5245Help
Entry
BMD_5245          CDS       T01219                                 

Gene name
walR
Definition
(GenBank) two-component response regulator WalR
  KO
K07668  two-component system, OmpR family, response regulator VicR
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMD_5245 (walR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmd02022]
    BMD_5245 (walR)
Two-component system [BR:bmd02022]
 OmpR family
  VicK-VicR (cell wall metabolism)
   BMD_5245 (walR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADF42044
UniProt: D5DMG0
LinkDB All DBs
Position
complement(5073978..5074685)
Genome map
AA seq 235 aa AA seqDB search
MDKRILVVDDEKPIADILKFNLQKEGYEVFCAYDGVEALEKVEEVQPEMILLDIMLPQKD
GMEVCREVRKKYDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRH
QQVAVPTEESETNEITIGALVIHPDAYIVSKRGETIELTHREFELLHYLAKHIGQVMTRE
HLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPMWIVTRRGVGYYLRSPEQE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggataaacgtattttagtcgtagatgacgaaaagccgattgcagatattttaaagttt
aatttgcaaaaagaaggttacgaagtattttgtgcttatgatggcgtagaagcacttgaa
aaagtggaagaagtacagcctgaaatgattttattagatattatgcttcctcagaaagat
ggaatggaagtttgccgagaagtgcgcaaaaaatatgatatgccaattatcatgttaaca
gcaaaagactctgaaattgacaaagttttaggtctagaattgggtgcagatgattatgta
actaagccgtttagtacgcgtgaattattagcacgtgtaaaagctaatttacgtagacat
cagcaggtagctgttccaacggaagaaagcgaaacgaatgaaattacgattggagcactt
gttattcacccagatgcctatatcgtgtctaagcgcggagaaacgattgaactgactcac
cgtgaatttgagctgctgcattatttagcgaagcacattggacaagtcatgacgcgtgaa
cacttgcttcaaactgtatggggttatgactattttggtgatgtgcgtacggtagatgta
acagttcgaagattacgtgaaaaaattgaagataatccaagccatccaatgtggattgta
acaagacgtggagtaggctattatttacgcagcccagagcaggagtaa

DBGET integrated database retrieval system