KEGG   Brucella melitensis bv. 1 16M: BMEI0582Help
Entry
BMEI0582          CDS       T00072                                 

Definition
(GenBank) d-alanine--d-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00473  D-Alanine metabolism
bme00550  Peptidoglycan biosynthesis
bme01100  Metabolic pathways
bme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMEI0582
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMEI0582
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMEI0582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bme01011]
    BMEI0582
Enzymes [BR:bme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMEI0582
Peptidoglycan biosynthesis and degradation proteins [BR:bme01011]
 Precursor biosynthesis
  Amino acid ligase
   BMEI0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAL51763
UniProt: Q8YI63
LinkDB All DBs
Position
I:602739..603686
Genome map
AA seq 315 aa AA seqDB search
MRRGEARMTGKHVAVLMGGFSSERSVSLSSGVACATTLEECGYRVTRIDVDRNVASILVE
LKPDVVFNALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVVVA
PSRLMNRFDIGSQHPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVIGSADWKYGDEVMV
EGYIAGRELTCAVMGDRAMDVCEIMPVGYQFYDYDSKYVAGASTHVCPAKILPNIYQKIQ
TMALTAHRAIGCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISF
AELLSWMVEDASCLR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaggggaagctagaatgacgggaaaacacgtcgccgttttgatgggtggtttt
tcttcggaacgctccgtcagcctttcctccggtgtggcctgtgcaacgacgcttgaagaa
tgcggctatcgcgtcacgcgcattgatgtggatcgcaatgttgcgagcatcctggtcgag
ttgaaacccgatgttgtgttcaacgccttgcacggccccttcggcgaagatggcgccatt
cagggcgtgcttgaatatctccagattccctacacacattccggcgtgctggcttccgcg
cttgcgatggacaaggatcgcgccaagaaggtggcggcagcggcgggcgtcgtggttgcg
ccgtcacgcctgatgaaccgtttcgacattggttcgcagcatccgatgaagccgccttac
gtggtgaagccggtgcgtgaagggtcgagcttcggtgtggtgatcgtcaaggaagatcag
ccgcatccgccgcaggtcatcggttcggccgattggaaatatggtgatgaggtcatggtc
gaaggctatattgccgggcgtgagctgacctgtgccgtgatgggggatcgcgccatggat
gtgtgcgagatcatgccggtcggttatcagttctacgactatgattcaaaatatgttgca
ggtgcatcaactcacgtgtgcccggcaaaaattttaccaaatatttaccaaaaaatacaa
acaatggcccttacggcgcatcgggcaatcgggtgtcggggcgtaagccggtcggacttc
cgtttcgatgatcgtttttctgaagaaggcgaagttgtctggctggaaatcaatacccag
ccggggatgactcctacctcgctcgtgcctgatatcgccaaagcggcgggtatctctttc
gctgagttgttgagttggatggtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system