KEGG   Brucella melitensis bv. 1 16M: BMEI0742Help
Entry
BMEI0742          CDS       T00072                                 

Definition
(GenBank) protein translation elongation factor tu (ef-tu)
  KO
K02358  elongation factor Tu
Organism
bme  Brucella melitensis bv. 1 16M
Brite
Translation factors [BR:bme03012]
 Eukaryotic Type
  Elongation factors
   BMEI0742
 Prokaryotic Type
   BMEI0742
Mitochondrial biogenesis [BR:bme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BMEI0742
Exosome [BR:bme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BMEI0742
  Exosomal proteins of breast cancer cells
   BMEI0742
  Exosomal proteins of colorectal cancer cells
   BMEI0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAL51923
UniProt: P64024
LinkDB All DBs
Position
I:768045..769265
Genome map
AA seq 406 aa AA seqDB search
MCWRLSGSRTKRTTAMAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQI
DAAPEERARGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAAD
GPMPQTREHILLARQVGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPI
IKGSALAALEDSSKELGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVV
TGRVERGIVKVGEEVEIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVE
RGQVLCKPGSVKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGT
EMVMPGDNVAMDVTLIVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgtgctggcgcttgagcggttctagaacaaagagaacaacggcgatggcaaagagtaag
tttgaacgtacgaagccccatgttaacatcggcacgattggtcacgttgaccatggcaag
acgtcgctgacggcggcgatcacgaagtttttcggcgaattcaaggcgtatgaccagatc
gacgctgcgcctgaagaacgcgcccgcggcatcacgatctcgacggcacacgtcgagtac
gaaaccgcaaaccgtcactatgcgcacgtcgattgccccggccacgccgactatgtgaag
aacatgatcaccggcgctgcccagatggatggcgcgatcctggtggtttcggctgctgac
ggcccgatgccgcagacccgcgagcacattctgcttgcccgtcaggttggcgttccggcg
attgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaactgctcgaactggtt
gaactggaagtgcgcgaacttctgtcgaagtacgaattccccggcgacgaaatcccgatc
atcaagggctcggctcttgctgctctggaagattcttccaaggaactgggcgaagatgcc
atccgcaacctgatggacgcggttgacagctacattccgaccccggaacgcccgatcgac
cagccgttcctgatgccgatcgaagacgtgttctcgatctccggccgtggtacggttgtg
acgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagttgaaatcgtcggcatc
aaggcgacgacgaagaccacggttaccggcgttgaaatgttccgcaagctgctcgaccag
ggccaggctggcgacaacattggcgcgctgatccgcggcgttggccgtgaagacgttgaa
cgcggccaggttctctgcaagccgggttctgtgaagccgcacaccaagtttaaggcagaa
gcctatattctgaccaaggatgaaggtggccgtcatacgccgttcttcaccaactaccgt
ccgcagttctacttccgtacgacggacgtgacgggtgttgtgacgcttccggctggcacg
gaaatggtcatgcctggcgataacgtcgccatggacgttaccctgatcgtgccgatcgcc
atggaagagaagcttcgcttcgctatccgtgaaggcggccgcaccgtcggtgccggcatc
gtctcgtcgatcatcgagtaa

DBGET integrated database retrieval system