KEGG   Brucella melitensis bv. 1 16M: BMEI1747Help
Entry
BMEI1747          CDS       T00072                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00620  Pyruvate metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEI1747
   00620 Pyruvate metabolism
    BMEI1747
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BMEI1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAL52928
UniProt: Q8YEY0
LinkDB All DBs
Position
I:complement(1787949..1789466)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGNERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaaaccggcttttgcaaaacgctatggcaat
ttcatcggcggcaaatgggtggaacccaggtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccagggagctatggggcaggacaagcgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggcggctgcc
gaaacatgggacaacggcaagccgatccgcgaaaccaccaatgccgacctgccgctggcg
gttgatcatttccgctatttcgcgggcgtcatccgcgctcaggaaggcggtatttctgaa
atcgatcacgatacggtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgca
ggcaattgcgtggtgctgaaacccgccgaacaaactccggcttccatcctcgtgctgatg
gagctcattgccgatattctgccgccgggtgtggtcaatatcgtcaatggtttcggcctt
gaggccggtaagccgctggcatccagcccccgcatcgccaagatcgccttcacgggtgag
acgacgaccggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacgctg
gagctgggcggcaagtcacccaacatcttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggccattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgcgctcattcaggaatcgatctatgacaggttcatggaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggccacgatgattggc
gcgcaggcatcgagcgaacaactcgaaaaaatcctgagctatctcgatattggccgtcag
gaaggtgcggaagtgctggcaggtaacgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggccggtcgtgtccgtcgcaaccttcaaggatgatgcggaggcgctatcg
attgccaatgacacactctatggcctcggtgcgggcatatggacgcgcgatggcacacgc
gcctatcgcttcggtcgcgccattaaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcgggcgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagcccgaag
aagcttggcttcttctaa

DBGET integrated database retrieval system