KEGG   Brucella melitensis bv. 1 16M: BMEI1749Help
Entry
BMEI1749          CDS       T00072                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00564  Glycerophospholipid metabolism
bme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMEI1749
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BMEI1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8 Mqo
Motif
Other DBs
NCBI-ProteinID: AAL52930
UniProt: Q8YEX8
LinkDB All DBs
Position
I:complement(1790802..1792337)
Genome map
AA seq 511 aa AA seqDB search
MVFAGRFSGYAMVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRAT
KLIHGGLRYLEHYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGL
FLYDHLGGRKKLPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADR
GAKIATRTSVVAASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQSVEGDRQ
LHNIRLVQGSHIVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKV
AITDSETDYLCQAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPD
GLAPLINVFGGKLTTARKLAEHMLQKIEHWLGRKGAPWTHAAPLPGGDFEDVAFETELKK
LEAAYPFLDARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAE
DILWRRTKLGLRLTAAEVAAVQGFVEPAIAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttggtgttcgcaggccggttttcggggtacgccatggtgcaggaaaaacaattcgatatt
tttattataggtggcggcatcaatggctgcggcattgcccgtgatgcggtggggcggggc
ttcaccgttgggctggccgagatgaacgatctggcaagcggcacctcttcgcgcgcaacc
aagctcattcacggtggtttgcgctatctggaacattatgaattccggctggtgcgcgag
gcgctgatggagcgcgaggtgctgtgggccaatgcgccgcatatcatccatccgatgcgt
ttcgtgctgccttatcataagggcggcctacgtcccgcctggctgttgcggcttggcctg
tttctttacgaccatctgggcggccgcaagaagcttcccgccacgcgcacgctcaacatg
cgcaccgacaaggccggcgaaccgctgaaaccgcttttcaccaaggcttttgaatattcc
gattgctgggtggacgatgcgcgcttcgtggcgctcaccgcccgcgatgcggctgatcgc
ggcgcgaagatcgcgacccgaacgagcgtcgttgccgcaagccgcgacgggcagggctgg
accatcacactggaagataccggcaccggcaggcgtgagaacgtacacgcccgccttctg
gtcaatgccgccgggccgtgggccgacaaggttctgcaaagtgtggaaggcgaccggcaa
ttgcacaatatccgtctggtgcagggcagccatatcgtcgtgcgcaggaagttttccgac
ccgcgcgcctatttcttccagaacaacgacgggcgcatcatcttcgccattccttatgaa
gatgatttcaccctgattggcaccacggatcaggattataagggcgacccggccaaggtg
gcgatcaccgacagcgagaccgattatctctgccaggcggcaagcgaatatttccgcgag
ccggtgcgccgggaggatatcgtctggacctattccggcgtgcgcccgctctatgatgac
ggggccagcaaggcgcaggaggcaacccgcgactatgtgctgaaggaagatgcgccagat
ggtctggcgccgctcatcaatgttttcggcggcaagctcaccacagcacgcaagcttgcc
gaacatatgctgcagaaaatcgagcactggcttggccgcaagggcgccccatggacccat
gcagcaccattgccaggcggggatttcgaggatgtggcttttgaaacggaactgaagaag
cttgaggcagcctatcctttccttgatgcgcgccgcctgttccggctctatggcacccgg
gcatataagcttttggggcaggcttcttcgctgggcgatcttggccgtcattttggcagc
gatctctatgaggcggaagtgcgctatcttgtcgaaaatgaatgggcgcgaagcgcggaa
gacattttgtggcggcgcaccaagctcggcctgcgcctgacggcggcggaagtcgcggcc
gtgcagggctttgtggagcctgcaatcgccgcctaa

DBGET integrated database retrieval system