KEGG   Burkholderia metallica: WJ16_07295Help
Entry
WJ16_07295        CDS       T04871                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bmec  Burkholderia metallica
Pathway
bmec00020  Citrate cycle (TCA cycle)
bmec00310  Lysine degradation
bmec00380  Tryptophan metabolism
bmec01100  Metabolic pathways
bmec01110  Biosynthesis of secondary metabolites
bmec01120  Microbial metabolism in diverse environments
bmec01130  Biosynthesis of antibiotics
bmec01200  Carbon metabolism
Module
bmec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WJ16_07295 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    WJ16_07295 (sucA)
   00380 Tryptophan metabolism
    WJ16_07295 (sucA)
Enzymes [BR:bmec01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WJ16_07295 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOJ31331
UniProt: A0A1B4HT21
LinkDB All DBs
Position
1:1645531..1648395
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHFPIVESFAERAKANAFIPRESTTNLAAARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESIRATPNFSADEKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKRGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADNYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAD
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatacctcaacaatccggcatcggtgccggagaactgg
cgagagtatttcgacgcgctgcagaacgttcctgcaaccgacggttcgaacgccaatgac
gtcgctcacttcccgatcgtcgaatcgttcgccgagcgcgcgaaggccaatgccttcatc
ccgcgcgaaagcaccaccaatctggctgcggcgcgcaagcaagtgcacgtgcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctggatcccctgaagcgtcgc
gaacgccccgccattcccgagctcgaacccgcgttctacgatttctccgaaggcgacctc
gaccagacgtacagcgcaagcaacctgtacttcggtttcgaccaggcttcgctgcgtgac
atcgtcaagggcctgcgcgacacgtactgcggcacgatcggcgccgaatacatgtacatc
agcgatccggagcagaagcgctggtggcaggagcgcctggagtcgatccgcgcgacgccg
aacttctcggcggacgagaagaagcacatcctcaatcgcctgacggccgccgaaggcctc
gagcgctacctgcataccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagcgcggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaatacgctgggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcg
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgacgatccggaagccgtcgtgctcgcg
acccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcatccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcaccgcggaagacgccgacaactacgtgaaggcgtaccgcaaggcgatg
gacgacggtcaccacacggtcgacccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggttccgttcctgaaccgcaagtggacggacgccgccgataccgccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacggtgccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgagcacctcgcgttcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaatcgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgac
ggtcaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcagtgctgggcttc
gaatacggctactcgaccgccgagccgaatacgctcgtgctgtgggaagcccagttcggc
gacttcgtcaacggtgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtatcgggtctcacgatgctgctgcctcacggctacgaaggccagggtccg
gaacactcgtccacgcgtatcgagcgtttcctgcagctgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtttgctcgggccgtgtgtattac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgatgtcgcgatcatccgtatcgag
cagctgtacccgttcgcgcacaagcagttcgaagccgaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccatctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcattcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system