KEGG   Burkholderia metallica: WJ16_07300Help
Entry
WJ16_07300        CDS       T04871                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmec  Burkholderia metallica
Pathway
bmec00020  Citrate cycle (TCA cycle)
bmec00310  Lysine degradation
bmec00380  Tryptophan metabolism
bmec01100  Metabolic pathways
bmec01110  Biosynthesis of secondary metabolites
bmec01120  Microbial metabolism in diverse environments
bmec01130  Biosynthesis of antibiotics
bmec01200  Carbon metabolism
Module
bmec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WJ16_07300
  09105 Amino acid metabolism
   00310 Lysine degradation
    WJ16_07300
   00380 Tryptophan metabolism
    WJ16_07300
Enzymes [BR:bmec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WJ16_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AOJ31332
UniProt: A0A1B4HT23
LinkDB All DBs
Position
1:1648531..1649808
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAA
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKAAAAKPSLPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagccgggcgaagcagttgctcaagacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcacccgccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacaccgtggtcgccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggggccgccgaagcagcggcaggcgccgccgaagtgaagccggcggcagca
cctgctgcagccgcaccggcagcacagccggccgccgcaaccgcatcgagctcggccgcc
gcatcgccggcagcatcgaagctgctcgccgagaagggcctgtcggcaggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggcagcaggcagcgcaccg
aaggccgctccggctgccgcaccggccaaggcggccgctgcgaagccgtcgctgccggaa
gtgaaggtgccggcatcggctgcgacctggctgaacgaccgtccggaacaacgcgtgccg
atgtcgcgcctgcgtgcgcgtattgccgagcgtctgctcgagtcgcagcagaccaacgcg
atcctgaccacgttcaacgaagtgaacatggccccggtcatggagctgcgtaacaagtac
aaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctaccacggttacttcgacatcggtatcgccgtcggctcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcaactgagcctcgcggagatcgaaaagaagatcgcc
gagttcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgtccggtcgtcgaaaacggc
cagatcgtgatccgtccgatcaactacctcgcgctgtcgtacgaccaccggatcatcgac
ggtcgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system