KEGG   Burkholderia metallica: WJ16_08955Help
Entry
WJ16_08955        CDS       T04871                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bmec  Burkholderia metallica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007 DUF5061 Halo_GVPC
Motif
Other DBs
NCBI-ProteinID: AOJ31627
UniProt: A0A1B4HTX8
LinkDB All DBs
Position
1:complement(2003870..2005306)
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDARDAIRAARAAFDAWAA
TPAATRAGYLRKIVEHLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAET
FEFEAQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAASVK
RVALELGGKSASVILDDADFATAVKGTVNACYLNAGQTCSAHTRMLVPEARYDEAREIAK
AAAETYVAGDPRQDATRLGALASAVQQQRVQAYIQRGIDEGAELVTGGTGMPDGLAKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
GVARRIRTGQVDINGGAWNMAAPFGGYKQSGHGRENGVYGLEEYLEYKSMQLKPAKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctatatcgacggcgcatggcgcaaaccggccggcaccggc
acgatcgacgtgatcgactcgggcaccgaggccgtgatcggccggattccggagggcgtc
gcgtccgacgcgcgggatgcgatccgcgcggcgcgggcggccttcgacgcgtgggcggcc
acgccggccgcgacgcgcgcgggctacctgcgcaagatcgtcgagcatctgcaggcgcgc
agcgaggaactcgcgcagtcgatcaccggcgaagtcgggatgccgatcaagctgtcgcgc
gcgatccaggtcggcggcccgatctacaactggaaggcgtacgcgaagctcgccgagacg
ttcgaattcgaggcgcaggtcggcaactcgctggtggtgcgcgagccggtcggcgtcgtc
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgcgccggcg
ctcgcggccggctgcacggtcgtcctgaagccgtccgaagtcgcgccgctcaacgcgttc
atgctggccgaagcgattcacgaagccgggctgccggccggcgtgttcaacctcgtgtgc
ggctacggcccggtcgtcggcgaggtgctggccaccgatccggacgtcgacatggtgtcg
ttcacgggctcgacgcgcgccggcaagcgcgtggccgagctggcggccgcgagcgtcaag
cgcgtcgcgctcgagctgggcggcaagtcggcctcggtgatcctcgacgatgccgatttc
gcgacggcggtgaagggcacggtcaatgcgtgctacctgaacgcggggcagacctgttcg
gcgcacacgcgcatgctggtgccggaggcccgctacgacgaggcgcgcgaaatcgcgaag
gcggcggccgaaacctacgtcgcgggcgatccgcggcaggacgcgacgcgcctcggcgcg
ctggcgtcggccgtgcagcagcagcgcgtgcaggcgtacatccagcgcgggattgacgaa
ggcgcggaactcgtcacgggtggcacgggtatgccggacgggctcgcgaagggcttcttc
gtgaagccgaccgtattcggccgcgtcgatccgaaatcgacgatcgcgcaggaagaaatc
ttcgggccggtgctgtcgatcatcacgtaccgcgacgaggacgaagccgtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggccggcagcgacgaacgcgcgatg
ggcgtcgcgcgccgcatccgcaccgggcaggtcgacatcaacggcggcgcgtggaacatg
gccgcgccgttcggcggctacaagcagtcgggtcacggccgcgagaacggcgtgtacggg
ctcgaagaatatctcgagtacaagtcgatgcaactcaagcccgcgaagccggcctga

DBGET integrated database retrieval system