KEGG   Burkholderia metallica: WJ16_14995Help
Entry
WJ16_14995        CDS       T04871                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmec  Burkholderia metallica
Pathway
bmec00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WJ16_14995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmec02000]
    WJ16_14995
Enzymes [BR:bmec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WJ16_14995
Transporters [BR:bmec02000]
 Other Transporters
  Pores ion channels [TC:1]
   WJ16_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AOJ32729
UniProt: A0A1B4HX43
LinkDB All DBs
Position
1:complement(3325553..3326191)
Genome map
AA seq 212 aa AA seqDB search
MNAYRLYLSPGTCSLAAHIALEETGAPFDVEIVSVRQQQNLEARYLAINAKARVPVLAIP
GEPRVLTETPAILTYLARRHPDAQLLPLGDSLREARCHEWLAWLVGWVHGVGYGALWRPG
RFIGDPALHGAVSTHGRGVIEAANDTIEAALADGRMWAEPGAHSIVDPFLFVLYRWGVAI
GLDMTRHPAWTAHAQREAERPAARRALAREAA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatatcgtctctatctttcgccgggcacctgctcgcttgccgcccacatcgcc
ctggaggaaaccggcgcgccgttcgacgtcgaaatcgtctccgtgcggcagcaacagaat
ctcgaagcgcgctatctcgcgatcaacgcgaaggcgcgcgtgccggtgctcgcgattccg
ggcgagccgcgcgtgctgaccgaaacgccggcgatcctcacgtatctcgcgcgccgtcat
cccgacgcgcaattgctgccgctcggcgattcgctgcgcgaggcgcggtgccacgaatgg
ctcgcgtggctggtcggctgggtgcacggtgtcggctacggcgcgctgtggcggccgggc
cgcttcatcggcgatccggcgctgcacggcgccgtcagcacgcacgggcgcggcgtgatc
gaagccgcaaacgacacgatcgaagcggcgctggccgacggccgtatgtgggccgagccc
ggcgcccactcgatcgtcgatccgttcctgttcgtgttgtatcgctggggtgtcgcgatc
gggctcgacatgacgcggcatcccgcgtggaccgcccatgcgcagcgcgaggccgaacga
ccggccgcccggcgcgcgctggcgcgggaagcggcctga

DBGET integrated database retrieval system