KEGG   Burkholderia metallica: WJ16_20045Help
Entry
WJ16_20045        CDS       T04871                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bmec  Burkholderia metallica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR RmlD_sub_bind Glyco_transf_4 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AOJ33921
UniProt: A0A1B4I0H1
LinkDB All DBs
Position
2:complement(47930..48652)
Genome map
AA seq 240 aa AA seqDB search
MSRQWTFEGRSVVVTGGTSGIGARTALRFAQAGASVVALGLDAAGPHAPVHAGIRCVELD
VTDSDALTRTIAALPRLDVLVNGVGISRHADEYRMDQFELVLNVNLTSVMRASDAAWPAL
SAHGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSRGLMADTHASRRILERTPLGRWGTADEVADVILFLCSPGASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcagtggacgtttgagggccggtccgtcgtcgtgacgggcggcacgtcgggc
atcggtgcccgcacggcgctgcggttcgcgcaagcgggcgcgtcggtcgtcgcgctcggg
ctcgatgcggccggcccgcatgcgcccgtgcatgcgggcatccggtgtgtggaactcgac
gtgaccgacagcgatgcgctgacgcgcacgatcgcggcgctgccgcggctcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgaataccggatggaccagttcgagctc
gtgctgaacgtgaacctgacgtcggtgatgcgtgcatcggacgccgcctggccggcgctg
tccgcgcacggcggcagcatcgtcaacgtcgcgtcgatgtacacgtacttcggcagcaag
gaccgccccgcgtacagcgcgagcaagggcggcatcgcgcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcatccgcgtgaacgcggtcgcgcccggctggatcgatacg
ccgctcagccgcggcctgatggccgacacgcacgcgtcgcggcgcatcctcgaacgcacg
ccgctcgggcgctggggcacggccgacgaagtcgcggacgtgatcctgttcctgtgctcg
cccggtgcgtcgttcgtgaccggtgcggtcgtgccggtcgacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system