KEGG   Burkholderia metallica: WJ16_20050Help
Entry
WJ16_20050        CDS       T04871                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmec  Burkholderia metallica
Pathway
bmec00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WJ16_20050
Enzymes [BR:bmec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WJ16_20050
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WJ16_20050
    1.1.1.-  
     WJ16_20050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Methyltransf_25 Methyltransf_11 DZR Methyltransf_12 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOJ33922
UniProt: A0A1B4I0H3
LinkDB All DBs
Position
2:complement(48630..49751)
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDTPRVGAGDVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
HRTAPLTLGHEFCGTVVEVGEDVTSLRAGDRVAVEPEYRCSQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDDVSLEQAAVMEPAAVALHALRRGQLRLGETCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAATRFGATHAFDARAYDAPALQDAIRAATG
GLGVDASFEAAGLQATFESAMRALRKGGRVVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAITDGFDALLADRTQIKILVSPAQRPARRAH
VTGSVEHESSVDV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacacgccg
cgcgtcggcgccggcgacgtgcgcatcgcggtcgcatattgcgggatctgcggcagcgac
ctgcacgaatatgcggacggcccgcatgcgatcccggtcgatgcaccgcatccgctgtcg
caccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggc
gaagacgtgacgtcactgcgcgcgggcgaccgtgtcgccgtcgaacccgaataccgctgc
agccagtgcgcgtactgccgctcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
ggactgatgggcgacggcgggatggccgacttcgcggtcgtgccggcctacatgctgcat
cgtctgccggacgacgtgagtctcgaacaggccgcggtgatggagccggccgccgtcgcg
ctgcacgcgctgcgccgcggccaactgcggctcggcgaaacctgtgcggtattcggcctc
gggccgatcggcctgctgctgatcatgctcgcgaagctgcagggcgcaaccacgatcgtg
gccgtcgacgtatcgcccgaacggctcgcggcagccacgcgctttggcgcgacgcatgcg
ttcgatgcgcgggcgtacgacgcaccggcgctgcaggacgccatccgcgcggccaccggc
gggctcggcgtcgacgcgagtttcgaagcggccgggttgcaggccacgttcgaatcggcg
atgcgggcgttgcgcaagggcggccgcgtcgtgatggtcggcctgatgccgcatgcgggc
ttcgacgcgttccgcgcggtcaacgacgagctgaccttcacggcaagcgtcggctaccgg
catgcgtacgaagacctgctgcgcatcgtcgcatcgggcgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaagacgccatcaccgacggcttcgacgcactgctcgcc
gatcgcacgcagatcaagatcctcgtttcacccgcgcagcggccggcccgtcgcgcacac
gtcaccgggagcgtcgagcatgagtcgtcagtggacgtttga

DBGET integrated database retrieval system