KEGG   Burkholderia metallica: WJ16_20060Help
Entry
WJ16_20060        CDS       T04871                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
Organism
bmec  Burkholderia metallica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AOJ33924
UniProt: A0A1B4I0I2
LinkDB All DBs
Position
2:complement(51073..51606)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPPIANPFKPDALPEAYIANAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILTAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDEAGNPDGYFDVHSYIAMCKAHYEKVGLGAHAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacattccgccgattgccaatccgttc
aagcccgatgcgctgcccgaagcgtacatcgcgaacgcggccaccgacgacgaacgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgacggccaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcttacacgctgtcagggaaatggggctatctggagcacgaatggact
gcgacgcgcggcgatttcgtgtacgagacaccgggcgagggccacacgctcgtcgcgttc
gaccaccccgaaccgatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gaagcaggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcacgcgatcgagaagctgttccgctga

DBGET integrated database retrieval system