KEGG   Burkholderia metallica: WJ16_20065Help
Entry
WJ16_20065        CDS       T04871                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
bmec  Burkholderia metallica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AOJ33925
UniProt: A0A1B4I0I3
LinkDB All DBs
Position
2:51785..52762
Genome map
AA seq 325 aa AA seqDB search
MTNSTVLSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
VADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRERCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPVTTFDDRLDAELAALPLRIAPKPGAGAMLGTTLRASVERFMKE
PLERDAARFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGDPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSVGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARASG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttctttcacgcacgcgaggctcgacggccgacgtgccggcgcgc
gacaggatggcgtactgggacgcgttcaacgcggcgacgctggtcgggttgcgttgctcg
tcgctttcgccggccgggctcgaggtcgagaaaaccgacatcgcgctgccgggcctcggc
gtcgccgacatcagcgggcaggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggaatcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgcgagcgctgcctgctcgcggaagcgggcgatgtggtcgtctacgacacgcgcgtgccc
tatctgttcggattcctgacaccgatgcggcagttgctgatcgatattccggtcacgacc
ttcgacgaccggctcgatgcggaactggccgcgctgccgctgcggatcgcgccgaagccc
ggcgcgggcgcgatgctcggcacgacgttgcgcgcgagcgtcgagcggttcatgaaggag
ccgctcgagcgcgacgccgcgcgcttcgccgaacacacgcgcacgctgatcgccgagctg
atcgatgcggaggtgaacggcgcgggcgcatcgcgtgcgtcgctgtcgtacctgctgacc
gcgaagcaatacatcgcgacgcatctcggcgatccggaactcgggccgcaggcggtcgcc
gacgcggtcgggctgtcgctgcggcatctgggccggctcttcgcggccgaaggcgaatcg
atcacgcagcacatctggtcggaacggctgtcgcatgcgcatcgcgaactgaccgatgcg
cggctgcgcaagacgagcgtcggcgaaatcgcatttcgctggggcttttcgagccaggcg
cacttcagccgtgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgacgcg
gcgcgcgcgagcggttga

DBGET integrated database retrieval system