KEGG   Burkholderia metallica: WJ16_22180Help
Entry
WJ16_22180        CDS       T04871                                 

Definition
(GenBank) FMN reductase
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
bmec  Burkholderia metallica
Pathway
bmec00350  Tyrosine metabolism
bmec00740  Riboflavin metabolism
bmec01100  Metabolic pathways
bmec01120  Microbial metabolism in diverse environments
bmec01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    WJ16_22180
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    WJ16_22180
Enzymes [BR:bmec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     WJ16_22180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: AOJ36218
UniProt: A0A1B4I719
LinkDB All DBs
Position
2:complement(542306..542851)
Genome map
AA seq 181 aa AA seqDB search
MSSTTDIPRPARVEPTDAQKAFRQAMAHLGAAVNVITTAGPHGRCGITASAVCSVTDTPP
TLLVCMNRSSAMHATFERNRHVCINVLPAEHEQLARHFAGLTDLPMERRFDLPVWERGEQ
DVPVLRDALASLQGTIADMKDVGSHSVMFIEASTIRVRDDGDSLIYFSRAFHRVSRTACV
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacgaccgatatcccgcgaccggcacgcgtcgagccgaccgacgcgcagaag
gccttccggcaagcgatggcccacctcggcgcggccgtcaacgtgatcaccaccgccggg
ccgcacggccgctgcgggatcaccgcgagcgccgtgtgctccgtcaccgatacgccgccg
acgctgctcgtgtgcatgaaccgttcgagcgcgatgcacgcgaccttcgagcgcaaccgg
catgtctgcatcaacgtgctgccggccgaacacgagcaactcgcgcgacacttcgcgggg
ctcaccgacctgccgatggaacggcgcttcgacctgcccgtgtgggagcgcggcgagcag
gacgtgccggtgctgcgcgacgcgctcgcgagcctgcagggcacgatcgccgacatgaag
gacgtcggctcgcattcggtgatgttcatcgaagccagcacgattcgcgtgcgcgacgac
ggcgacagcctgatctacttcagccgggcgtttcatcgcgtgtcgcgcaccgcgtgcgtg
cggtga

DBGET integrated database retrieval system