KEGG   Burkholderia metallica: WJ16_24520Help
Entry
WJ16_24520        CDS       T04871                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmec  Burkholderia metallica
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WJ16_24520
Enzymes [BR:bmec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WJ16_24520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like DAO K_oxygenase Thi4 Glutaredoxin FAD_oxidored NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AOJ34731
UniProt: A0A1B4I2S3
LinkDB All DBs
Position
2:complement(1071682..1073280)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDGAKSQELLALLNEIASLTDRVSVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEFGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGDTQRIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSIPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAPVAAAQPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcgtcgctcgacgacggcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgagcgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggcgggcatccgcttcgccggc
atcccgatggggcatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactacgcg
ttcgaaacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggtgcgagc
gcgcgcgccgcgaaatcgctggaaaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcgggcgcggccgcggccatctattcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaatttcgtctcg
gtgcaggaaaccgaagggccgaagttcgcgaccgcgctcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgcggatgcgctgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgttctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggaagtcacgctgatc
gaattcggcgcgcaactgcgggcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagacgaccgagctgaccggcgacgggagcaagctg
aacgggctcgtctacaaggatctgcgctcgggcgacacgcagcgcatcgagctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcgataccgggcgtattc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtgggcgaaggc
gcgaaggcatcgctcggcgcgttcgatcacctgatccggcaggacgtggcgccggtggcc
gccgcgcagccgcaggccgaagaggccgtcgccgcgtaa

DBGET integrated database retrieval system