KEGG   Burkholderia metallica: WJ16_31335Help
Entry
WJ16_31335        CDS       T04871                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bmec  Burkholderia metallica
Pathway
bmec00250  Alanine, aspartate and glutamate metabolism
bmec00410  beta-Alanine metabolism
bmec00640  Propanoate metabolism
bmec00650  Butanoate metabolism
bmec01100  Metabolic pathways
bmec01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WJ16_31335
   00650 Butanoate metabolism
    WJ16_31335
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WJ16_31335
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WJ16_31335
Enzymes [BR:bmec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WJ16_31335
Amino acid related enzymes [BR:bmec01007]
 Aminotransferase (transaminase)
  Class III
   WJ16_31335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOJ35957
UniProt: A0A1B4I6B8
LinkDB All DBs
Position
2:2679624..2680913
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgctaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgctgcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacaccggccaccgccac
ccgaagatcgtcaaggcgatcgcggaccagctgaacaacttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgagaagatcaacgagcgcgcgccgggc
gatttcccgaagaagacggcgttcttcacgaccggcgccgaagccgtcgagaacgcgatc
aagatcgcgcgggcggccaccggccgtccgggcgtgatcgccttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacg
acggccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcaaacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctcgccgacctgatcacgatggcgaagagcctggcgggcggcatgccgctgtcgggcgtc
gtcggccgtgccgacctgatggacgcggcagcgcccggcggcctcggcggcacgtacgcc
ggcaacccgctggcggtcgcatcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgcaacgcagctcggcgacgtgctgaaggccaagctgaacgcactgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcaggctcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcactcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system