KEGG   Brevundimonas mediterranea: GYM46_13860Help
Entry
GYM46_13860       CDS       T06564                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmed  Brevundimonas mediterranea
Brite
KEGG Orthology (KO) [BR:bmed00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GYM46_13860 (ahpF)
Enzymes [BR:bmed01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GYM46_13860 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 AlaDh_PNT_C HI0933_like NAD_binding_7 DAO Glutaredoxin Thi4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QIH73943
LinkDB All DBs
Position
2818925..2820511
Genome map
AA seq 528 aa AA seqDB search
MLDANLKSQLEAYLKNIVHPVELVASLGAGPKSQELKTLLEEIVSVSHGKVEMGRDYDDE
RQPSFLIRRKGTDIGVRFAGIPLGHEFTSLVLALLHVGGHPSKAAQEVIQQVKDLEGDYV
FETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIEGGLFKDEVEERKIMAVPTVFLNGEL
FGQGRMELEQIVARLDSGAEARAAERLKSKDPFDVLVVGGGPAGAAAAIYTARKGIRTGI
VAERFGGQVLDTMAIENFISVPHTEGPKLAAHLEQHVREYEVDIMNLQKAARLVPAEVPG
GLHEVVLENGASLKSRTVILATGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEFDSELRADAVLQRKLATLPNVRIVTSALTTQVQGD
GEKVTGLSYKDRNSDAHHDVDLEGVFVQIGLVPNTEWLRGAVALTARGEIEVDHRGETSQ
PGIFGAGDVTTVPYKQIVIAMGEGSKAGLSAFDYMIRTIPAEEAVEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaaatctcagctcgaggcctatctgaagaacatcgtccatccg
gtcgaactggtcgcctcgctgggcgccgggccgaagtcgcaggagctgaagaccctgctg
gaggagatcgtctcggtctcgcacggcaaggtcgagatgggccgcgactatgacgacgaa
cgccagcccagcttcctgatccgccgcaagggcacggacatcggcgtgcggttcgcgggc
attccgctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccat
ccgtccaaggcggcgcaggaggtgatccagcaggtcaaggacctggagggcgactatgtg
ttcgagacctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggccctgaac
ctgatgagcgtgctgaacccgcgcatcaaacacgtcgccatcgagggcggcctgttcaag
gacgaggtcgaggaacgcaagatcatggccgtgccgacggtcttcctgaacggcgaactg
ttcggccagggccggatggagctggagcagatcgtcgcccggctggattcgggcgccgag
gcgcgggccgccgaacggctgaagtccaaggacccgttcgacgttctggtggtcggcggc
ggccccgccggggcggcggccgccatctatacggcgcgcaagggcatccgcaccggcatc
gtggccgagcggttcggcggccaggtgctggacaccatggcgatcgagaacttcatttcg
gtgccgcacaccgaggggccgaaactggccgctcatctggaacagcatgtccgcgagtac
gaggtggacatcatgaacctgcagaaggcggccaggctggttccggctgaggttcccggc
ggtctgcacgaggtggtgctggagaacggcgcgagcctgaaatcgcgcaccgtgatcctg
gccaccggcgcccgctggcgccagatgaacgtgccgggcgaggaccagtacaagaacaag
ggcgtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcgggtggccgtg
atcggcggcggcaactcgggcgtcgaggcggccatcgatctggcgggcatcgtggcccat
gtgaccctgatcgagttcgacagcgaactgagggccgatgcggtgctgcaacgcaagctg
gcgaccctgccgaacgtgcggatcgtcacctcggccctgacgactcaggtgcagggcgac
ggcgagaaggtgacgggcctgtcctacaaggaccgcaactcggacgcccatcatgacgtc
gatctggaaggcgtcttcgtccagatcggcctggtgccgaacaccgaatggctgcgcggc
gccgtggccctgacggcgcgcggggagatcgaggtggatcatcgcggcgagacctcgcag
ccgggcatattcggcgcgggcgacgtgaccaccgtgccctacaagcagatcgtcatcgcc
atgggcgaaggctccaaggcggggctgtcggccttcgactatatgatccgcacgattccg
gccgaagaggcggtcgaggcggcttag

DBGET integrated database retrieval system