KEGG   Brucella melitensis bv. 3 Ether: DK62_1213Help
Entry
DK62_1213         CDS       T03393                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00010  Glycolysis / Gluconeogenesis
bmee00620  Pyruvate metabolism
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK62_1213 (acoD)
   00620 Pyruvate metabolism
    DK62_1213 (acoD)
Enzymes [BR:bmee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DK62_1213 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ86026
LinkDB All DBs
Position
1:complement(1204235..1205752)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVKPRSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaaaccggcttttgcaaaacgctatggcaat
ttcatcggcggcaaatgggtgaaacccaggtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccagggagctatggggcaggacaagcgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggcggctgcc
gaaacatgggacaacggcaagccgatccgcgaaaccaccaatgccgacctgccgctggcg
gttgatcatttccgctatttcgcgggcgtcatccgcgctcaggaaggcggtatttctgaa
atcgatcacgatacggtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgca
ggcaattgcgtggtgctgaaacccgccgaacaaactccagcttccatcctcgtgctgatg
gagctcattgccgatattctgccgccgggtgtggtcaatatcgtcaatggtttcggcctt
gaggccggtaagccgctggcatccagcccccgcatcgccaagatcgccttcacgggtgag
acgacgaccggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacgctg
gagctgggcggcaagtcacccaacatcttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggccattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgcgctcattcaggaatcgatctatgacaggttcatggaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggccacgatgattggc
gcgcaggcatcgagcgaacaactcgaaaaaatcctgagctatctcgatattggccgtcag
gaaggtgcggaagtgctggcaggtggcgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggccggtcgtgtccgtcgcaaccttcaaggatgatgcggaggcgctatcg
attgccaatgacacactctatggcctcggtgcgggcatatggacgcgcgatggcacacgc
gcctatcgcttcggtcgcgccattaaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcgggcgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagcccgaag
aagcttggcttcttctaa

DBGET integrated database retrieval system