KEGG   Brucella melitensis bv. 3 Ether: DK62_1557Help
Entry
DK62_1557         CDS       T03393                                 

Definition
(GenBank) shikimate kinase family protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01130  Biosynthesis of antibiotics
bmee01230  Biosynthesis of amino acids
Module
bmee_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK62_1557
Enzymes [BR:bmee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DK62_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 RsgA_GTPase AAA_30 TsaE AAA_22 APS_kinase AAA 6PF2K AAA_17 SRP54 AAA_5 CPT AAA_16 DUF815 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AIJ86462
LinkDB All DBs
Position
1:1571090..1571692
Genome map
AA seq 200 aa AA seqDB search
MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIET
VSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISI
WINADLDVLMERVSRRQNRPLLRNSDLRGVMQRLMDERYPVYALAQLHLMTRDEKKEVIA
AELIEVLAAHLEKEQAASAG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtacgaacaaacaaacaaatcttcacaggcagacggaaacgatccgccagctg
ctcggcagtaaagtggttgttctcgttggcctgatgggagccggaaaatccaccatcggc
cgcaaggtggcgaacatgctcaacctgccgttcaaggatgcggatacggaaattgaaact
gtttcgcggatgactgttgccgaactgttcgaggcctatggggaagtggaatttcgcgat
ctcgaacgtcgcgtgatcctgcgccttctcgatgacggccccatggtgctggcgaccggc
ggcggcgcctatatgaacgccgaaacccgcgcggcgattgccgaagcggggatttccatc
tggattaatgccgatctcgacgtcttgatggagcgcgtttcgcgccgccagaaccgtccc
cttttgagaaacagcgatctgcgcggcgtcatgcagcggctgatggacgagcgctacccg
gtttatgcgctggcccagctgcatctgatgacgcgcgatgagaaaaaggaagtgattgcc
gcagaactgatcgaggttctggcggcgcatctggaaaaggaacaggccgcttccgccgga
tga

DBGET integrated database retrieval system