KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_1760Help
Entry
BG04_1760         CDS       T03825                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00020  Citrate cycle (TCA cycle)
bmeg00480  Glutathione metabolism
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
bmeg01120  Microbial metabolism in diverse environments
bmeg01130  Biosynthesis of antibiotics
bmeg01200  Carbon metabolism
bmeg01210  2-Oxocarboxylic acid metabolism
bmeg01230  Biosynthesis of amino acids
Module
bmeg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmeg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BG04_1760 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG04_1760 (icd)
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BG04_1760 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJI25439
UniProt: A0A0B6AZU0
LinkDB All DBs
Position
complement(1617192..1618478)
Genome map
AA seq 428 aa AA seqDB search
MTKGEQISVANGVLNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVAKAYNGEKEIVWKE
VLAGEKAFNQTGEWLPEETLDAIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFDGVPSPIKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLVSFLQTELGVNKIR
FPETSGLGIKPISSEGTERLVRAAINYAIEQGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EKEFGDKVFTWAQYDRIVEKEGAQAANKAQAEAEAAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLMLEHLGWNEAADLIMKSMEKTIASKVVTYDFARLMDGATEVKCSEFADELIS
NLGKQVTV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggtgaacaaatttctgtagcaaacggcgtgttaaacgtaccaaataaccca
attattccatttatcgaaggtgacggaattggcccggatatctgggcagcagcttctcgc
gtattagaagcagcggttgcaaaagcatacaatggtgaaaaagaaatcgtttggaaagaa
gtattagcaggtgaaaaagcatttaatcaaactggcgaatggttaccggaagaaacgtta
gatgcaattcgcgaatacataattgcaatcaaaggaccattaacaacaccagtaggcggt
ggaattcgttctctaaacgtggcattgcgtcaagaattagacttattcacatgcttacgt
cctgttcgctactttgacggcgtaccttctccaattaagcgccctgaagatacagatatg
gttatcttccgtgaaaataccgaagatatttatgctggtattgaatatgcgaagggttct
gaagaagtacaaaagcttgtttcattcctacaaacggaattaggcgtaaataaaatccgt
ttccctgaaacttctggattaggtattaagcctatttcttctgaaggaacagagcgtctt
gtgcgtgcagcaatcaactatgcaattgaacaaggccgcaagtctgttacgcttgtacac
aaaggtaacattatgaaatatacagaaggcgcatttaaaaattggggctatgagctagct
gaaaaagaattcggcgataaagtatttacttgggctcaatatgaccgtatcgttgaaaaa
gaaggtgcacaggctgcaaacaaagctcaagcagaagcggaagcagcaggaaaaattatt
gtaaaagattcaattgcagatatcttcttacaacaaattttaactcgtccacgtgaattc
gatgtagtagcaacaatgaatttaaatggagattacatttcagatgcattagcagcacaa
gttggtggtatcggaattgctccaggagcaaacatcaactatgaaactggacatgctatc
tttgaagcaactcacggtacagcacctaaatatgctggtttagataaagtaaacccatct
tctgtattattatcaggtgtgttaatgcttgaacaccttggctggaacgaagcagcggat
ttaattatgaaatcaatggaaaaaacaattgcttcaaaagtagtaacatatgatttcgca
cgtttaatggatggtgcaacagaagtgaagtgttcagagttcgctgatgaattaattagc
aatctaggaaaacaagtaacagtttaa

DBGET integrated database retrieval system